Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 6.5e-18
ovarian cancer 8520 7.3e-07

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.100 7.3e-07
psoriasis -2.200 6.5e-18

AA Sequence

MAPQTLLLVLVLCVLLLQAQGGYRDKMRMQRIKVCEKRPSIDLCIHHCSYFQKCETNKICCSAFCGNICM      1 - 70
SIL                                                                        71 - 73
//

Text Mined References (6)

PMID Year Title