Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 6.49031189854849E-18
ovarian cancer 8492 7.28898774957965E-7

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.100 0.000
psoriasis -2.200 0.000

AA Sequence

MAPQTLLLVLVLCVLLLQAQGGYRDKMRMQRIKVCEKRPSIDLCIHHCSYFQKCETNKICCSAFCGNICM      1 - 70
SIL                                                                        71 - 73
//

Text Mined References (6)

PMID Year Title
23292442 2013 Reproduction and immunity-driven natural selection in the human WFDC locus.
15950183 2005 The evolution of a genetic locus encoding small serine proteinase inhibitors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12206714 2002 A locus on human chromosome 20 contains several genes expressing protease inhibitor domains with homology to whey acidic protein.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.