Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.15
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 6.7e-09
lung adenocarcinoma 2716 2.7e-05
Multiple Sclerosis 540 3.1e-02
Disease Target Count Z-score Confidence
Prostatitis 18 3.133 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma 1.700 2.7e-05
Multiple Sclerosis 1.100 3.1e-02
psoriasis -1.500 6.7e-09

AA Sequence

MMLSCLFLLKALLALGSLESWITAGEHAKEGECPPHKNPCKELCQGDELCPAEQKCCTTGCGRICRDIPK      1 - 70
GRKRDCPRVIRKQSCLKRCITDETCPGVKKCCTLGCNKSCVVPISKQKLAEFGGECPADPLPCEELCDGD     71 - 140
ASCPQGHKCCSTGCGRTCLGDIEGGRGGDCPKVLVGLCIVGCVMDENCQAGEKCCKSGCGRFCVPPVLPP    141 - 210
KLTMNPNWTVRSDSELEIPVP                                                     211 - 231
//

Text Mined References (7)

PMID Year Title