Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.63
PubTator Score 2.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3232 9.4e-06
medulloblastoma, large-cell 6241 1.2e-04
Disease Target Count Z-score Confidence
Appendicitis 15 3.234 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.100 9.4e-06
medulloblastoma, large-cell 1.100 1.2e-04

Gene RIF (3)

AA Sequence

MASVQASRRQWCYLCDLPKMPWAMVWDFSEAVCRGCVNFEGADRIELLIDAARQLKRSHVLPEGRSPGPP      1 - 70
ALKHPATKDLAAAAAQGPQLPPPQAQPQPSGTGGGVSGQDRYDRATSSGRLPLPSPALEYTLGSRLANGL     71 - 140
GREEAVAEGARRALLGSMPGLMPPGLLAAAVSGLGSRGLTLAPGLSPARPLFGSDFEKEKQQRNADCLAE    141 - 210
LNEAMRGRAEEWHGRPKAVREQLLALSACAPFNVRFKKDHGLVGRVFAFDATARPPGYEFELKLFTEYPC    211 - 280
GSGNVYAGVLAVARQMFHDALREPGKALASSGFKYLEYERRHGSGEWRQLGELLTDGVRSFREPAPAEAL    281 - 350
PQQYPEPAPAALCGPPPRAPSRNLAPTPRRRKASPEPEGEAAGKMTTEEQQQRHWVAPGGPYSAETPGVP    351 - 420
SPIAALKNVAEALGHSPKDPGGGGGPVRAGGASPAASSTAQPPTQHRLVARNGEAEVSPTAGAEAVSGGG    421 - 490
SGTGATPGAPLCCTLCRERLEDTHFVQCPSVPGHKFCFPCSREFIKAQGPAGEVYCPSGDKCPLVGSSVP    491 - 560
WAFMQGEIATILAGDIKVKKERDP                                                  561 - 584
//

Text Mined References (21)

PMID Year Title