Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.81
PubTator Score 0.20

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
osteosarcoma 7766 1.4e-06
interstitial cystitis 2237 4.5e-03
Disease Target Count Z-score Confidence
Synovial sarcoma 25 3.536 1.8


  Differential Expression (2)

Disease log2 FC p
interstitial cystitis 1.200 4.5e-03
osteosarcoma -2.623 1.4e-06

Gene RIF (1)

AA Sequence

AVQSLQLSPRTRGSWSQPQPLKAPCLNGDTT                                           981 - 1011

Text Mined References (11)

PMID Year Title