Property Summary

Ligand Count 8
NCBI Gene PubMed Count 32
PubMed Score 50.05
PubTator Score 77.30

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.200 3.0e-03
ependymoma -1.500 2.2e-03
group 3 medulloblastoma -1.700 3.6e-03
medulloblastoma, large-cell -1.200 7.2e-03
oligodendroglioma -1.300 4.5e-03
pancreatic ductal adenocarcinoma liver m... -2.515 7.7e-03
primitive neuroectodermal tumor -1.400 7.6e-03

Protein-protein Interaction (1)

Gene RIF (14)

AA Sequence

MASALSYVSKFKSFVILFVTPLLLLPLVILMPAKFVRCAYVIILMAIYWCTEVIPLAVTSLMPVLLFPLF      1 - 70
QILDSRQVCVQYMKDTNMLFLGGLIVAVAVERWNLHKRIALRTLLWVGAKPARLMLGFMGVTALLSMWIS     71 - 140
NTATTAMMVPIVEAILQQMEATSAATEAGLELVDKGKAKELPGSQVIFEGPTLGQQEDQERKRLCKAMTL    141 - 210
CICYAASIGGTATLTGTGPNVVLLGQMNELFPDSKDLVNFASWFAFAFPNMLVMLLFAWLWLQFVYMRFN    211 - 280
FKKSWGCGLESKKNEKAALKVLQEEYRKLGPLSFAEINVLICFFLLVILWFSRDPGFMPGWLTVAWVEGE    281 - 350
TKYVSDATVAIFVATLLFIVPSQKPKFNFRSQTEEERKTPFYPPPLLDWKVTQEKVPWGIVLLLGGGFAL    351 - 420
AKGSEASGLSVWMGKQMEPLHAVPPAAITLILSLLVAVFTECTSNVATTTLFLPIFASMSRSIGLNPLYI    421 - 490
MLPCTLSASFAFMLPVATPPNAIVFTYGHLKVADMVKTGVIMNIIGVFCVFLAVNTWGRAIFDLDHFPDW    491 - 560
ANVTHIET                                                                  561 - 568
//

Text Mined References (34)

PMID Year Title