Property Summary

NCBI Gene PubMed Count 10
PubMed Score 33.41
PubTator Score 36.19

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
interstitial cystitis -1.200 0.023
adult high grade glioma -1.400 0.001
inflammatory breast cancer -1.600 0.003

Gene RIF (5)

PMID Text
25916677 may exacerbate inflammation and support osteoclast formation and bone destruction
23619471 The present study demonstrated that SOFAT may play an important role in periodontitis.
21299892 THNSL2 was found to have bimodal expression in human skeletal muscle tissue.
19877052 A cytokine named SOFAT (secreted osteoclastogenic factor of activated T cells) can induce osteoblastic IL-6 production and osteoclast formation in the absence of osteoblasts or RANKL. It is insensitive to RANKL inhibitor osteoprotegerin.
18976975 Knockdown of threonine synthase-like 2 (THNSL2) by siRNA has both activating and inhibiting activities on HIV-1 replication in HeLa P4/R5 cells, suggesting a regulatory role in HIV replication

AA Sequence

MWYVSTRGVAPRVNFEGALFSGYAPDGGLFMPEELPQLDRGTLCQWSTLSYPGLVKELCALFIGSELLPK      1 - 70
DELNDLIDRAFSRFRHREVVHLSRLRNGLNVLELWHGVTYAFKDLSLSCTTQFLQYFLEKREKHVTVVVG     71 - 140
TSGDTGSAAIESVQGAKNMDIIVLLPKGHCTKIQELQMTTVLKQNVHVFGVEGNSDELDEPIKTVFADVA    141 - 210
FVKKHNLMSLNSINWSRVLVQMAHHFFAYFQCTPSLDTHPLPLVEVVVPTGAAGNLAAGYIAQKIGLPIR    211 - 280
LVVAVNRNDIIHRTVQQGDFSLSEAVKSTLASAMDIQVPYNMERVFWLLSGSDSQVTRALMEQFERTQSV    281 - 350
NLPKELHSKLSEAVTSVSVSDEAITQTMGRCWDENQYLLCPHSAVAVNYHYQQIDRQQPSTPRCCLAPAS    351 - 420
AAKFPEAVLAAGLTPETPAEIVALEHKETRCTLMRRGDNWMLMLRDTIEDLSRQWRSHALNTSQ          421 - 484
//

Text Mined References (12)

PMID Year Title
25916677 2015 In vitro evaluation of the biological effect of SOFAT on osteoblasts.
23619471 2013 Secreted osteoclastogenic factor of activated T cells (SOFAT), a novel osteoclast activator, in chronic periodontitis.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21299892 2011 Bimodal distribution of RNA expression levels in human skeletal muscle tissue.
19877052 2009 A novel T cell cytokine, secreted osteoclastogenic factor of activated T cells, induces osteoclast formation in a RANKL-independent manner.
17034760 2006 A threonine synthase homolog from a mammalian genome.
16413481 2006 Genome-wide prediction of mammalian enhancers based on analysis of transcription-factor binding affinity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...