Property Summary

NCBI Gene PubMed Count 12
PubMed Score 37.46
PubTator Score 36.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
adult high grade glioma 3801 1.5e-03
inflammatory breast cancer 286 3.4e-03
interstitial cystitis 2312 2.3e-02
Disease Target Count Z-score Confidence
Cherubism 13 3.012 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma -1.400 1.5e-03
inflammatory breast cancer -1.600 3.4e-03
interstitial cystitis -1.200 2.3e-02

Gene RIF (7)

AA Sequence

MWYVSTRGVAPRVNFEGALFSGYAPDGGLFMPEELPQLDRGTLCQWSTLSYPGLVKELCALFIGSELLPK      1 - 70
DELNDLIDRAFSRFRHREVVHLSRLRNGLNVLELWHGVTYAFKDLSLSCTTQFLQYFLEKREKHVTVVVG     71 - 140
TSGDTGSAAIESVQGAKNMDIIVLLPKGHCTKIQELQMTTVLKQNVHVFGVEGNSDELDEPIKTVFADVA    141 - 210
FVKKHNLMSLNSINWSRVLVQMAHHFFAYFQCTPSLDTHPLPLVEVVVPTGAAGNLAAGYIAQKIGLPIR    211 - 280
LVVAVNRNDIIHRTVQQGDFSLSEAVKSTLASAMDIQVPYNMERVFWLLSGSDSQVTRALMEQFERTQSV    281 - 350
NLPKELHSKLSEAVTSVSVSDEAITQTMGRCWDENQYLLCPHSAVAVNYHYQQIDRQQPSTPRCCLAPAS    351 - 420
AAKFPEAVLAAGLTPETPAEIVALEHKETRCTLMRRGDNWMLMLRDTIEDLSRQWRSHALNTSQ          421 - 484
//

Text Mined References (14)

PMID Year Title