Property Summary

NCBI Gene PubMed Count 8
PubMed Score 9.88
PubTator Score 127.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
adult high grade glioma 3801 5.5e-03
group 3 medulloblastoma 4104 1.1e-02

Expression

  Differential Expression (2)

Disease log2 FC p
adult high grade glioma 1.600 5.5e-03
group 3 medulloblastoma 1.100 1.1e-02

 GO Process (1)

Protein-protein Interaction (2)

Gene RIF (4)

AA Sequence

MLKSRLRMFLNELKLLVLTGGGRPRAEPQPRGGRGGGCGWAPFAGCSTRDGDGDEEEYYGSEPRARGLAG      1 - 70
DKEPRAGPLPPPAPPLPPPGALDALSLSSSLDSGLRTPQCRICFQGPEQGELLSPCRCDGSVRCTHQPCL     71 - 140
IRWISERGSWSCELCYFKYQVLAISTKNPLQWQAISLTVIEKVQIAAIVLGSLFLVASISWLIWSSLSPS    141 - 210
AKWQRQDLLFQICYGMYGFMDVVCIGLIIHEGSSVYRIFKRWQAVNQQWKVLNYDKTKDIGGDAGGGTAG    211 - 280
KSGPRNSRTGPTSGATSRPPAAQRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVVMRVTTV        281 - 346
//

Text Mined References (8)

PMID Year Title