Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.45
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Substance-Related Disorders 114
Disease Target Count P-value
astrocytoma 1493 7.16537764364612E-25
oligodendroglioma 2849 3.35014526889591E-16
posterior fossa group A ependymoma 1511 4.6928828374812E-11
glioblastoma 5572 3.73225811046982E-9
pilocytic astrocytoma 3086 1.86714241835236E-8
pituitary cancer 1972 6.58793821359058E-8
acute quadriplegic myopathy 1157 5.20047861726719E-7
pediatric high grade glioma 2712 8.02762670702982E-7
tuberculosis 1563 7.26311949358809E-5
interstitial cystitis 2299 2.11354881927371E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 3.81591675896496E-4
ulcerative colitis 2087 3.9517159934002E-4
atypical teratoid / rhabdoid tumor 4369 4.91419741080364E-4
sonic hedgehog group medulloblastoma 1482 0.00153817281730281
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00159138568242101
medulloblastoma, large-cell 6234 0.013521316941494
ovarian cancer 8492 0.0190997776385593
primitive neuroectodermal tumor 3031 0.02615448975968

Expression

Synonym

Accession Q86YD5 B7Z1U3 B9EG81 Q8NBJ0
Symbols LRAD3

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA Inparanoid
Xenopus OMA EggNOG

Pathway (1)

Gene RIF (4)

PMID Text
26854353 LRAD3 is a component of pathways that function effectively to modulate Itch and Nedd4 auto-ubiquitination and levels.
21795536 LRAD3 that modulates amyloid precursor protein trafficking.
20410850 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MWLLGPLCLLLSSAAESQLLPGNNFTNECNIPGNFMCSNGRCIPGAWQCDGLPDCFDKSDEKECPKAKSK      1 - 70
CGPTFFPCASGIHCIIGRFRCNGFEDCPDGSDEENCTANPLLCSTARYHCKNGLCIDKSFICDGQNNCQD     71 - 140
NSDEESCESSQEPGSGQVFVTSENQLVYYPSITYAIIGSSVIFVLVVALLALVLHHQRKRNNLMTLPVHR    141 - 210
LQHPVLLSRLVVLDHPHHCNVTYNVNNGIQYVASQAEQNASEVGSPPSYSEALLDQRPAWYDLPPPPYSS    211 - 280
DTESLNQADLPPYRSRSGSANSASSQAASSLLSVEDTSHSPGQPGPQEGTAEPRDSEPSQGTEEV         281 - 345
//

Text Mined References (9)

PMID Year Title
26854353 2016 Regulation of Itch and Nedd4 E3 Ligase Activity and Degradation by LRAD3.
21795536 2011 LRAD3, a novel low-density lipoprotein receptor family member that modulates amyloid precursor protein trafficking.
20410850 2010 Analysis of 9p24 and 11p12-13 regions in autism spectrum disorders: rs1340513 in the JMJD2C gene is associated with ASDs in Finnish sample.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.