Property Summary

NCBI Gene PubMed Count 28
PubMed Score 11.36
PubTator Score 6.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.700 1.9e-05
colon cancer -1.100 1.5e-04
dermatomyositis 1.100 2.2e-03
gastric carcinoma -1.400 1.7e-02
glioblastoma -1.300 1.9e-04
invasive ductal carcinoma -1.200 6.9e-04
lung adenocarcinoma -1.100 4.9e-14
lung cancer -1.100 1.1e-02
malignant mesothelioma -1.300 9.1e-07
medulloblastoma, large-cell -1.900 1.6e-06
non-small cell lung cancer -1.312 4.5e-26
ovarian cancer -2.100 1.5e-10
psoriasis 1.100 2.1e-04

Gene RIF (5)

AA Sequence

MSYGPLDMYRNPGPSGPQLRDFSSIIQTCSGNIQRISQATAQIKNLMSQLGTKQDSSKLQENLQQLQHST      1 - 70
NQLAKETNELLKELGSLPLPLSTSEQRQQRLQKERLMNDFSAALNNFQAVQRRVSEKEKESIARARAGSR     71 - 140
LSAEERQREEQLVSFDSHEEWNQMQSQEDEVAITEQDLELIKERETAIRQLEADILDVNQIFKDLAMMIH    141 - 210
DQGDLIDSIEANVESSEVHVERATEQLQRAAYYQKKSRKKMCILVLVLSVIILILGLIIWLVYKTK        211 - 276
//

Text Mined References (36)

PMID Year Title