Property Summary

NCBI Gene PubMed Count 28
PubMed Score 11.36
PubTator Score 6.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 4.49695502056714E-26
lung adenocarcinoma 2714 4.93728800379989E-14
ovarian cancer 8492 1.4985983901283E-10
malignant mesothelioma 3163 9.0719763857311E-7
medulloblastoma, large-cell 6234 1.63112388495303E-6
atypical teratoid / rhabdoid tumor 4369 1.85577611542825E-5
colon cancer 1475 1.47066091686631E-4
glioblastoma 5572 1.87197630914741E-4
psoriasis 6685 2.09098144272274E-4
invasive ductal carcinoma 2950 6.94638859557923E-4
lung cancer 4473 0.00152889700863972
dermatomyositis 967 0.00216427955270865
gastric carcinoma 832 0.0173699509381293
Disease Target Count Z-score Confidence
Disease of anatomical entity 25 0.0 2.0
Disease Target Count Z-score Confidence
Typhoid fever 22 4.057 2.0
Hermansky-Pudlak syndrome 43 3.374 1.7

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
psoriasis 1.100 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
glioblastoma -1.300 0.000
medulloblastoma, large-cell -1.900 0.000
non-small cell lung cancer -1.312 0.000
lung cancer -1.700 0.002
colon cancer -1.100 0.000
lung adenocarcinoma -1.100 0.000
gastric carcinoma -1.400 0.017
invasive ductal carcinoma -1.200 0.001
ovarian cancer -2.100 0.000
dermatomyositis 1.100 0.002

Synonym

Accession Q86Y82 B1AJQ7 O95564
Symbols STX13
STX14

Gene

PDB

2DNX  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (5)

PMID Text
26208634 STX13 acts as a fusion SNARE in melanosomal trafficking pathways.
24496451 The association of Src, EGFR and beta1 integrin is dependent upon membrane traffic that is mediated by syntaxin13 (officially known as STX12) and SNAP23.
24095276 Data indicate that knockdown of syntaxin 13 (syx13) further increased the cellular toxicity caused by mutant CHMP2B (CHMP2BIntron5) expression.
19910495 the importance of syntaxin-13 in the trafficking of matrix metalloproteinases during degradation of extracellular matrix substrates and subsequent cellular invasion
15469992 ABCA1 forms a complex with syntaxin 13 and flotillin-1, residing at the plasma membrane and in phagosomes that are partially located in raft microdomains

AA Sequence

MSYGPLDMYRNPGPSGPQLRDFSSIIQTCSGNIQRISQATAQIKNLMSQLGTKQDSSKLQENLQQLQHST      1 - 70
NQLAKETNELLKELGSLPLPLSTSEQRQQRLQKERLMNDFSAALNNFQAVQRRVSEKEKESIARARAGSR     71 - 140
LSAEERQREEQLVSFDSHEEWNQMQSQEDEVAITEQDLELIKERETAIRQLEADILDVNQIFKDLAMMIH    141 - 210
DQGDLIDSIEANVESSEVHVERATEQLQRAAYYQKKSRKKMCILVLVLSVIILILGLIIWLVYKTK        211 - 276
//

Text Mined References (36)

PMID Year Title
26359495 2015 The Q-soluble N-Ethylmaleimide-sensitive Factor Attachment Protein Receptor (Q-SNARE) SNAP-47 Regulates Trafficking of Selected Vesicle-associated Membrane Proteins (VAMPs).
26208634 2015 STX13 regulates cargo delivery from recycling endosomes during melanosome biogenesis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24496451 2014 SNARE-dependent interaction of Src, EGFR and ?1 integrin regulates invadopodia formation and tumor cell invasion.
24095276 2013 Syntaxin 13, a genetic modifier of mutant CHMP2B in frontotemporal dementia, is required for autophagosome maturation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
More...