Property Summary

NCBI Gene PubMed Count 36
PubMed Score 129.44
PubTator Score 50.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.200 2.7e-02
Astrocytoma, Pilocytic 1.200 2.9e-04
atypical teratoid / rhabdoid tumor -2.000 1.7e-03
Breast cancer -1.200 2.7e-04
cystic fibrosis 2.655 4.3e-07
ependymoma -1.500 4.1e-02
intraductal papillary-mucinous neoplasm ... 1.500 2.2e-02
invasive ductal carcinoma -1.100 4.9e-02
malignant mesothelioma -6.700 1.2e-08
medulloblastoma, large-cell -2.400 8.1e-04
ovarian cancer 1.200 1.2e-02
pituitary cancer 2.000 4.3e-04

Gene RIF (33)

AA Sequence

MVAAPCARRLARRSHSALLAALTVLLLQTLVVWNFSSLDSGAGERRGGAAVGGGEQPPPAPAPRRERRDL      1 - 70
PAEPAAARGGGGGGGGGGGGRGPQARARGGGPGEPRGQQPASRGALPARALDPHPSPLITLETQDGYFSH     71 - 140
RPKEKVRTDSNNENSVPKDFENVDNSNFAPRTQKQKHQPELAKKPPSRQKELLKRKLEQQEKGKGHTFPG    141 - 210
KGPGEVLPPGDRAAANSSHGKDVSRPPHARKTGGSSPETKYDQPPKCDISGKEAISALSRAKSKHCRQEI    211 - 280
GETYCRHKLGLLMPEKVTRFCPLEGKANKNVQWDEDSVEYMPANPVRIAFVLVVHGRASRQLQRMFKAIY    281 - 350
HKDHFYYIHVDKRSNYLHRQVLQVSRQYSNVRVTPWRMATIWGGASLLSTYLQSMRDLLEMTDWPWDFFI    351 - 420
NLSAADYPIRTNDQLVAFLSRYRDMNFLKSHGRDNARFIRKQGLDRLFLECDAHMWRLGDRRIPEGIAVD    421 - 490
GGSDWFLLNRRFVEYVTFSTDDLVTKMKQFYSYTLLPAESFFHTVLENSPHCDTMVDNNLRITNWNRKLG    491 - 560
CKCQYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKFEAVVNQEIIGQLDYYLYGNYPAGTPGLRSY    561 - 630
WENVYDEPDGIHSLSDVTLTLYHSFARLGLRRAETSLHTDGENSCRYYPMGHPASVHLYFLADRFQGFLI    631 - 700
KHHATNLAVSKLETLETWVMPKKVFKIASPPSDFGRLQFSEVGTDWDAKERLFRNFGGLLGPMDEPVGMQ    701 - 770
KWGKGPNVTVTVIWVDPVNVIAATYDILIESTAEFTHYKPPLNLPLRPGVWTVKILHHWVPVAETKFLVA    771 - 840
PLTFSNRQPIKPEEALKLHNGPLRNAYMEQSFQSLNPVLSLPINPAQVEQARRNAASTGTALEGWLDSLV    841 - 910
GGMWTAMDICATGPTACPVMQTCSQTAWSSFSPDPKSELGAVKPDGRLR                         911 - 959
//

Text Mined References (36)

PMID Year Title