Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.05
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma 1.200 3.7e-04
atypical teratoid / rhabdoid tumor 2.300 1.4e-02
medulloblastoma, large-cell 1.500 4.7e-05
nasopharyngeal carcinoma -1.200 3.6e-07
ovarian cancer 1.400 6.5e-03

AA Sequence

MEWKLERTAPRRVRTEEEMLWESIMRVLSKDLKQKRSQDSANVLDSVNATYSDFKSNFAKRLSAEVPVAS      1 - 70
SPITTRWQQSQTRALSSDSFGEEQSTTYLPEASGSVLKTPPEKETLTLGSRKEQLKTPSKGISETSNSAL     71 - 140
HFCKAPHAMDRDWKESVASKGQKCLKQLFVTQNVVQQANGKMQLCEQSECVWKGCKDGVRDESFHLKSSG    141 - 210
DINDSILQPEVKIHITGLRNDYYLNILDWSFQNLVAIALGSAVYIWNGENHNGIENIDLSLTCNYISSVS    211 - 280
WIKEGTCLAVGTSEGEVQLWDVVTKKRLRNMLGHLSVVGALSWNHFILSSGSRLGRVYHHDVRVAQHHVG    281 - 350
TLRHKQAVCALKWSPDGRLLSSGCSDGLLTIWPHDPGASAQGQPLKVITQSTAVKAMDWCPWQSGVLAIG    351 - 420
GGMKDGRLHILDINAGKSIQTPSTNSQICSLIWLPKTKEIATGQGTPKNDVTVWTCPTVSRSGGFFGHRG    421 - 490
RVLHLSLSPDQTRVFSAAADGTASVWNCY                                             491 - 519
//

Text Mined References (6)

PMID Year Title