Property Summary

NCBI Gene PubMed Count 3
PubMed Score 72.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2499 3.18 1.6

Synonym

Accession Q86Y28
Symbols CT2.4
MLL3P

Gene

AA Sequence

MAAGAVFLALSAQLLQARLMKEESPVVSWWLEPEDGTAL                                     1 - 39
//

Text Mined References (3)

PMID Year Title