Property Summary

NCBI Gene PubMed Count 3
PubMed Score 66.07

Knowledge Summary


No data available


  Disease Relevance (1)

Disease Z-score Confidence
Cancer 2,346 3.17 1.6


Accession Q86Y28
Symbols CT2.4


AA Sequence

MAAGAVFLALSAQLLQARLMKEESPVVSWWLEPEDGTAL                                     1 - 39

Publication (3)

PMID Year Title
12676563 2003 BAGE genes generated by juxtacentromeric reshuffling in the Hominidae lineage are under selective pressure.
12461691 2002 New BAGE (B melanoma antigen) genes mapping to the juxtacentromeric regions of human chromosomes 13 and 21 have a cancer/testis expression profile.
7895173 1995 BAGE: a new gene encoding an antigen recognized on human melanomas by cytolytic T lymphocytes.