Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.13
PubTator Score 2.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
breast carcinoma 1614 8.44675613143907E-33
psoriasis 6685 3.56429441579905E-15
astrocytoma 1493 2.53029067630821E-14
oligodendroglioma 2849 1.63528017440447E-10
Breast cancer 3099 3.59036041866566E-10
non-small cell lung cancer 2798 2.36489638125165E-9
pilocytic astrocytoma 3086 6.82413603876144E-7
glioblastoma 5572 1.47769247177864E-6
osteosarcoma 7933 1.01068497253287E-4
primitive neuroectodermal tumor 3031 1.66323318642123E-4
atypical teratoid / rhabdoid tumor 4369 4.02904963063911E-4
group 4 medulloblastoma 1875 4.50572006156921E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 7.78492390932049E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.35073967394305E-4
pediatric high grade glioma 2712 0.00101232809524704
interstitial cystitis 2299 0.00107443336946711
invasive ductal carcinoma 2950 0.00490597411676997
ductal carcinoma in situ 1745 0.0129264024095344
spina bifida 1064 0.0163546375194791
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0256923091441593
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

Synonym

Accession Q86XU0
Symbols

Gene

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Cow OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
25504438 our results demonstrate that ZNF677 is trancriptionally regulated by methylation in non-small cell lung cancers and suggest that ZNF677 has tumor cell growth suppressing properties

AA Sequence

MALSQGLFTFKDVAIEFSQEEWECLDPAQRALYRDVMLENYRNLLSLDEDNIPPEDDISVGFTSKGLSPK      1 - 70
ENNKEELYHLVILERKESHGINNFDLKEVWENMPKFDSLWDYDVKNYKGMPLTCNKNLTHRKDQQHNKSS     71 - 140
IHFSLKQSVSIRDSAHQYFIHDKPFIRNLLKLKNNIRYAGNKYVKCFENKIGLSLQAQLAELQRFQTGEK    141 - 210
MYECNPVEKSINSSSVSPLPPCVKNICNKYRKILKYPLLHTQYGRTHIREKSYKCNDCGKAFSKSSNLTN    211 - 280
HQRIHSGQRPYKCNECGKAFNQCSNLTRHQRVHTGEKPYQCNICGKVCSQNSNLASHQRMHTGEKPYKCN    281 - 350
ECGKAFIQRSHLWGHERIHTGEKPYKCNECDKAFAERSSLTQHKRIHTGEKPYICNECGKAFKQCSHLTR    351 - 420
HQNIHPGEKPHKCNVCGRAFIQSSSLVEHQRIHTGEKPYKCNKCDKAFIKRSHLWGHQRTHTGEKPYKCT    421 - 490
ECGKAFTERSNLTQHKKIHTGEKPYKCTECGKAFTQFANLTRHQKIHIEKKHCKHNIHGNALFQSSNLGD    491 - 560
HQKSYNREKHIKYNETKIKYSSCT                                                  561 - 584
//

Text Mined References (4)

PMID Year Title
25504438 2015 DNA methylation transcriptionally regulates the putative tumor cell growth suppressor ZNF677 in non-small cell lung cancers.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.