Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.13
PubTator Score 2.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma 1.200 8.9e-03
astrocytoma 1.200 2.5e-14
Astrocytoma, Pilocytic 1.200 6.1e-07
atypical teratoid / rhabdoid tumor 1.100 4.0e-04
Breast cancer -1.200 1.2e-08
breast carcinoma -1.500 8.4e-33
ductal carcinoma in situ -1.200 1.3e-02
glioblastoma 1.100 7.3e-06
group 3 medulloblastoma 1.400 4.6e-05
interstitial cystitis -1.200 1.3e-03
intraductal papillary-mucinous adenoma (... -1.100 2.6e-02
intraductal papillary-mucinous carcinoma... -2.300 9.4e-04
intraductal papillary-mucinous neoplasm ... -2.700 7.8e-04
invasive ductal carcinoma -1.900 5.0e-03
non-small cell lung cancer -1.176 1.2e-08
oligodendroglioma 1.100 1.6e-10
osteosarcoma 2.516 1.0e-04
primitive neuroectodermal tumor 1.700 1.7e-04
psoriasis -1.300 1.1e-28
spina bifida -1.058 1.6e-02

Gene RIF (1)

AA Sequence

MALSQGLFTFKDVAIEFSQEEWECLDPAQRALYRDVMLENYRNLLSLDEDNIPPEDDISVGFTSKGLSPK      1 - 70
ENNKEELYHLVILERKESHGINNFDLKEVWENMPKFDSLWDYDVKNYKGMPLTCNKNLTHRKDQQHNKSS     71 - 140
IHFSLKQSVSIRDSAHQYFIHDKPFIRNLLKLKNNIRYAGNKYVKCFENKIGLSLQAQLAELQRFQTGEK    141 - 210
MYECNPVEKSINSSSVSPLPPCVKNICNKYRKILKYPLLHTQYGRTHIREKSYKCNDCGKAFSKSSNLTN    211 - 280
HQRIHSGQRPYKCNECGKAFNQCSNLTRHQRVHTGEKPYQCNICGKVCSQNSNLASHQRMHTGEKPYKCN    281 - 350
ECGKAFIQRSHLWGHERIHTGEKPYKCNECDKAFAERSSLTQHKRIHTGEKPYICNECGKAFKQCSHLTR    351 - 420
HQNIHPGEKPHKCNVCGRAFIQSSSLVEHQRIHTGEKPYKCNKCDKAFIKRSHLWGHQRTHTGEKPYKCT    421 - 490
ECGKAFTERSNLTQHKKIHTGEKPYKCTECGKAFTQFANLTRHQKIHIEKKHCKHNIHGNALFQSSNLGD    491 - 560
HQKSYNREKHIKYNETKIKYSSCT                                                  561 - 584
//

Text Mined References (4)

PMID Year Title