Property Summary

NCBI Gene PubMed Count 10
PubMed Score 143.02
PubTator Score 5.71

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q86XS8 J3KN31 Q32P32 Q59EL1 Q641P9 Q6P177 Q7L2U2 Q9P0J9
Symbols GP
G1RZFP
GOLIATH

Gene

Gene RIF (3)

PMID Text
16549277 GOLIATH, a paralog of GRAIL, is a new E3 ligase protein, expressed in leukocytes.
13679316 Cloning and functional analysis of the rat counterpart.
10806348 Cloning and functional analysis of the mouse counterpart.

AA Sequence

MSCAGRAGPARLAALALLTCSLWPARADNASQEYYTALINVTVQEPGRGAPLTFRIDRGRYGLDSPKAEV      1 - 70
RGQVLAPLPLHGVADHLGCDPQTRFFVPPNIKQWIALLQRGNCTFKEKISRAAFHNAVAVVIYNNKSKEE     71 - 140
PVTMTHPGTGDIIAVMITELRGKDILSYLEKNISVQMTIAVGTRMPPKNFSRGSLVFVSISFIVLMIISS    141 - 210
AWLIFYFIQKIRYTNARDRNQRRLGDAAKKAISKLTTRTVKKGDKETDPDFDHCAVCIESYKQNDVVRIL    211 - 280
PCKHVFHKSCVDPWLSEHCTCPMCKLNILKALGIVPNLPCTDNVAFDMERLTRTQAVNRRSALGDLAGDN    281 - 350
SLGLEPLRTSGISPLPQDGELTPRTGEINIAVTKEWFIIASFGLLSALTLCYMIIRATASLNANEVEWF     351 - 419
//

Text Mined References (13)

PMID Year Title
21347282 2011 Genome-wide association study of coronary heart disease and its risk factors in 8,090 African Americans: the NHLBI CARe Project.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16797685 2006 Differential expression profiling of genes in a complete hydatidiform mole using cDNA microarray analysis.
16549277 2006 h-Goliath, paralog of GRAIL, is a new E3 ligase protein, expressed in human leukocytes.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
13679316 2004 Goliath, a ring-H2 mitochondrial protein, regulated by luteinizing hormone/human chorionic gonadotropin in rat leydig cells.
More...