Property Summary

NCBI Gene PubMed Count 33
Grant Count 99
R01 Count 60
Funding $10,672,013.9
PubMed Score 11.56
PubTator Score 26.12

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q86XR7 B3Y698 Q6JUT2 TICAM-2
Symbols TIRP
TRAM
TIRAP3
MyD88-4
TICAM-2

Gene

PDB

2M1W  

Protein-protein Interaction (11)

Gene RIF (17)

PMID Text
26408662 Data show that Toll/IL-1R domain-containing adaptor molecule (TICAM)-2 possesses two conserved acidic amino acids, D91 and E92, which regulate TICAM-2 self-activation and signaling.
25521228 Findings were SNPs in TICAM2 (P = 3.6 x 10(-6)) and IL1B (P = 4.3 x 10(-5)) associated with TB.
25385819 TRAM acts as a sorting adaptor not only for TLR4, but also for TLR2, to facilitate signaling to IRF7 at the endosome, which explains how TLR2 is capable of causing type I IFN induction.
25211222 TRAM plays a role in TLR7 signaling through a novel signaling axis towards the activation of anti-viral immunity.
24812060 A putative TRAF6-binding motif in TRAM may mediate a new TRAM function in TLR4 signaling in regulating inflammatory responses, distinct from its bridging TLR4 and TRIF. A TRAM E183A mutation abolished this.
24255114 The homotypic interaction between TICAM-2 TIR is indispensable to present a scaffold for recruiting the monomeric moiety of the TICAM-1 TIR dimer.
23136947 results suggest TLR adaptor molecules knockdown, such as MyD88 or TRAM, can decrease IL-6 and IL-8 mRNA and increase CXCL12 mRNA expression in HGF and HPDLF.
22970235 induction of both IL-6 and IL-8 is associated with elevated TIRAP and reduced TRAM mRNA expression
22685567 Data indicate that MyD88 works together with the IL-1/IL-18 receptors, can interact with two distinct sorting adaptors, TRAM and Mal, in a conserved manner.
20802145 viral inhibitor peptide of TLR4 possibly represents a surface domain of A46 that specifically inhibits TLR4 by masking critical binding sites on MyD88 adaptor-like and TRIF-related adaptor molecule
More...

AA Sequence

MGIGKSKINSCPLSLSWGKRHSVDTSPGYHESDSKKSEDLSLCNVAEHSNTTEGPTGKQEGAQSVEEMFE      1 - 70
EEAEEEVFLKFVILHAEDDTDEALRVQNLLQDDFGIKPGIIFAEMPCGRQHLQNLDDAVNGSAWTILLLT     71 - 140
ENFLRDTWCNFQFYTSLMNSVNRQHKYNSVIPMRPLNNPLPRERTPFALQTINALEEESRGFPTQVERIF    141 - 210
QESVYKTQQTIWKETRNMVQRQFIA                                                 211 - 235
//

Publication (36)

PMID Year Title
26592460 2016 SARM modulates MyD88-mediated TLR activation through BB-loop dependent TIR-TIR interactions.
26408662 2015 Identification of a Regulatory Acidic Motif as the Determinant of Membrane Localization of TICAM-2.
25736436 2015 WDFY1 mediates TLR3/4 signaling by recruiting TRIF.
25521228 2015 Polymorphisms in TICAM2 and IL1B are associated with TB.
25416956 2014 A proteome-scale map of the human interactome network.
25385819 2014 TRAM is required for TLR2 endosomal signaling to type I IFN induction.
25211222 2014 The TIR-domain containing adaptor TRAM is required for TLR7 mediated RANTES production.
24812060 2014 The TLR signaling adaptor TRAM interacts with TRAF6 to mediate activation of the inflammatory response by TLR4.
24255114 2013 Structures and interface mapping of the TIR domain-containing adaptor molecules involved in interferon signaling.
23136947 2013 MyD88 or TRAM knockdown regulates interleukin (IL)-6, IL-8, and CXCL12 mRNA expression in human gingival and periodontal ligament fibroblasts.
More...