Property Summary

NCBI Gene PubMed Count 34
PubMed Score 14.57
PubTator Score 26.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Brain Injuries 65 0.0 0.0

Expression

 GO Function (1)

 MGI Phenotype (1)

 GWAS Trait (1)

Gene RIF (18)

AA Sequence

MGIGKSKINSCPLSLSWGKRHSVDTSPGYHESDSKKSEDLSLCNVAEHSNTTEGPTGKQEGAQSVEEMFE      1 - 70
EEAEEEVFLKFVILHAEDDTDEALRVQNLLQDDFGIKPGIIFAEMPCGRQHLQNLDDAVNGSAWTILLLT     71 - 140
ENFLRDTWCNFQFYTSLMNSVNRQHKYNSVIPMRPLNNPLPRERTPFALQTINALEEESRGFPTQVERIF    141 - 210
QESVYKTQQTIWKETRNMVQRQFIA                                                 211 - 235
//

Text Mined References (37)

PMID Year Title