Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
22082156 Knockdown of zinc finger protein 761 (ZNF761) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N

AA Sequence

MAFSQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCTMKEFLSTAQGNREVFH      1 - 70
AGTLQIHESHHNGDFCYQDVDKDIHDYEFQWQEDERNGHEAPMTKIKKLTGSTERYDQSHARNKPIKDQL     71 - 140
GSSFHSHLPEMHIFQTEEKIDNQVVKSIHDASLVSTAQRISCRPKTHISNNHGNNFWNSSLLTQKQEVHM    141 - 210
REKSFQCNESGKAFNYSSLLRKHQIIHLADKYKCDVCGKLFNQKRNLACHRRCHTGENPYKCNECGKTFS    211 - 280
QTSSLTCHRRLHTGEKPYKCEECDKAFHFKSILERHRIIHTEEKPYKCNECGKTFRQKSILTRHHRLHTG    281 - 350
EKPYKCNECGKTFSHKSSLTCHHRLHTGEKPYKCNECGKTFSHKSSLTCHRRLHTGEKPYKCEECDKAYS    351 - 420
FRSNFEIHRKIHTEDNAYKCNECGKTFSRTSSLTCHRRRHTGEQPYKCEECDKAFRFKSNLERHRRIHTG    421 - 490
EKPYKCNECGKTFSRKSYLTCHHRLHTGEKAYKCNECSKTFSWKSSLTCHRRLHSGEKPYKCKECGKTFN    491 - 560
QQLTLKRHRRLHSGENPYKCEDSDKAYSFKSNLEIHQKIHTEQNPYKCNECGKTFSRTSSLTCHRRLHTG    561 - 630
EKPYKCEECDKAFRVKSNLEGHRRIHTGEKPYKCNECGKTFSRKSYFVCHHRLHTGEKPYKCNECGKNFS    631 - 700
QKSSLICHHRLHTGEKPYKCNECGKTFSQKSNLTCHRRLHTGEKQV                            701 - 746
//

Publication (5)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.