Property Summary

NCBI Gene PubMed Count 11
PubMed Score 18.40
PubTator Score 14.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.300 3.5e-02
ependymoma 1.300 3.0e-06
group 3 medulloblastoma 1.800 2.7e-04
osteosarcoma -1.653 8.2e-05
tuberculosis and treatment for 3 months -1.200 1.9e-06

 GO Component (2)

Gene RIF (3)

AA Sequence

MAEGEKNQDFTFKMESPSDSAVVLPSTPQASANPSSPYTNSSRKQPMSATLRERLRKTRFSFNSSYNVVK      1 - 70
RLKVESEENDQTFSEKPASSTEENCLEFQESFKHIDSEFEENTNLKNTLKNLNVCESQSLDSGSCSALQN     71 - 140
EFVSEKLPKQRLNAEKAKLVKQVQEKEDLLRRLKLVKMYRSKNDLSQLQLLIKKWRSCSQLLLYELQSAV    141 - 210
SEENKKLSLTQLIDHYGLDDKLLHYNRSEEEFIDV                                       211 - 245
//

Text Mined References (15)

PMID Year Title