Property Summary

NCBI Gene PubMed Count 11
Grant Count 9
R01 Count 6
Funding $433,878.42
PubMed Score 18.43
PubTator Score 14.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.700 0.048
osteosarcoma -1.653 0.000
ependymoma 1.300 0.000
group 3 medulloblastoma 1.800 0.000
tuberculosis and treatment for 6 months -1.400 0.000

 GO Component (2)

Gene RIF (3)

PMID Text
23874500 SFR1 is a novel transcriptional modulator for ERalpha and a potential target in breast cancer therapy.
21252223 that human SWI5-MEI5 has an evolutionarily conserved function in homologous recombination repair.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAEGEKNQDFTFKMESPSDSAVVLPSTPQASANPSSPYTNSSRKQPMSATLRERLRKTRFSFNSSYNVVK      1 - 70
RLKVESEENDQTFSEKPASSTEENCLEFQESFKHIDSEFEENTNLKNTLKNLNVCESQSLDSGSCSALQN     71 - 140
EFVSEKLPKQRLNAEKAKLVKQVQEKEDLLRRLKLVKMYRSKNDLSQLQLLIKKWRSCSQLLLYELQSAV    141 - 210
SEENKKLSLTQLIDHYGLDDKLLHYNRSEEEFIDV                                       211 - 245
//

Publication (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23874500 2013 DNA homologous recombination factor SFR1 physically and functionally interacts with estrogen receptor alpha.
23551011 2013 Genome-wide association study of pre-eclampsia detects novel maternal single nucleotide polymorphisms and copy-number variants in subsets of the Hyperglycemia and Adverse Pregnancy Outcome (HAPO) study cohort.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21779174 2011 The epistatic relationship between BRCA2 and the other RAD51 mediators in homologous recombination.
21252223 2011 The role of the human SWI5-MEI5 complex in homologous recombination repair.
20976249 2010 Role for the mammalian Swi5-Sfr1 complex in DNA strand break repair through homologous recombination.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
More...