Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Polycystic ovary syndrome 360 0.0 0.0

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.700 5.7e-04
atypical teratoid / rhabdoid tumor -1.300 1.5e-04
glioblastoma -1.600 1.7e-04
medulloblastoma -1.100 2.3e-03
medulloblastoma, large-cell -1.300 1.3e-04
osteosarcoma -1.892 1.7e-08

Gene RIF (2)

AA Sequence

MERPEPPPGTAAGQEEQELRERAFFSWAEFSRFFDAWCQQRLALFFVKSSMHLARCRWASAPPLYTLIDV      1 - 70
LKYSYVRLVCKDVRAPSRPAVGPPQPGCPAFIIVKLSPLRDRLVVTECQLTHSHPACPLEFAYYFRPGHL     71 - 140
LANACLPVRTTNKISKQFVAPADVRRLLSYCKGRDHGVLDALHVLEGLFRTDPEAKVKLVFVEDQAVVET    141 - 210
VFFLTSRTRALLRRFPRMLLVDRLPGLQGALDLLAVLCVDGSGRARQAACCVARPGTPSLLRFALASLLQ    211 - 280
SAPDVKGRVRCLTAGPEVAAQLPAVRQLLPCARVQICRAQGLETLFSKAQELGGAGREDPGLWSRLCRLA    281 - 350
GASSPAAYDEALAELHAHGPAAFVDYFERNWEPRRDMWVRFRAFEAARDLDACALVRGHRRRLLRRLSPS    351 - 420
RGVAQCLRDLVAMQWADAAGEAVPEGPDGGGPWLEDEPGRGAQGENERVRGLETGDWGGAPKEGSIWRGA    421 - 490
QMEKEWARALETRDWGGAQFEGEKGRALQIRDWRGGRLENQKPRGLEGGVLRGSKLEKGHLRGPEIRDWR    491 - 560
GPQLEGEKDWGLEGYVWRGSQLEDQALRGLEGYTWRVAQLEDRRSTTDLRGTQFDYERGKGESTEDR       561 - 627
//

Text Mined References (6)

PMID Year Title