Property Summary

NCBI Gene PubMed Count 8
Grant Count 2
Funding $38,135
PubMed Score 4.80
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
posterior fossa group B ependymoma 2.200 0.000
glioblastoma -1.800 0.000
group 3 medulloblastoma -2.500 0.000
interstitial cystitis -1.300 0.000
adult high grade glioma -2.000 0.001
pilocytic astrocytoma -2.200 0.000
nasopharyngeal carcinoma -2.000 0.000
Breast cancer -2.200 0.000
lung carcinoma -1.400 0.000
ovarian cancer 3.100 0.000
pituitary cancer -1.700 0.014
chronic rhinosinusitis -1.842 0.005
cystic fibrosis and chronic rhinosinusit... -1.239 0.041
facioscapulohumeral dystrophy 2.600 0.000

Synonym

Accession Q86XH1 B4DFH9 E7EWQ0 Q4G164 Q53R37 Q53RV3 Q96NS7 Q9H680
Symbols IQCA
DRC11
4930465P12Rik

Gene

 Grant Application (2)

 GO Function (1)

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
18854154 Knockdown of IQ motif containing with AAA domain 1 (IQCA1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MSNAMYNKMWHQTQEALGALLDKEPQKMIEPQRNQVFIFQTLATFYVKYVQIFRNLENVYDQFVHPQKRI      1 - 70
LIRKVLDGVMGRILELKNEMVELELTEFHYFDDILQDLKLAPQQLDIPIPKYFLKEKLEVIKGREKILAQ     71 - 140
ILADSGIDTSDMKYPVKSIPFDEAVKLIQIAERARQGRLRALFMKQIYLQEYRAKQSKMLGKKVTDTWAA    141 - 210
ALRIQKVWRRFHQRKETEKLREEEMIFLGMNPPPLFNEVSATVIQAEKVDRLRNEVQIKHEEDYREALVT    211 - 280
IKNDLKLIEGVDIKENLQDQIRHWFIECRNLTGTFPDYPDVEEGGSAIIFSDKTIQQVIEDIIANQEEEE    281 - 350
KNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEKWKMSPSLFLPAMKEGCNAYKEIWMKKDESWNFSQDYD    351 - 420
PELIKEEKRKELQSEIRIQVDELMRQELKNLKLAVDRERERPVKAGKKKDKKGKKGKKKEKKAKKDKDLT    421 - 490
ADRTIESLYKELVEEGLLIQALKVNLSDYIGEYSYLGTTLRQVSIEPMPSLLDVRQLITLYGIWPLGSAA    491 - 560
VHEKAPLVKSLLLAGPSGVGKKMLVHAICTETGANLFNLSSSNIAGKYPGKNGLQMMLHAVFKVARQLQP    561 - 630
SVVWIEDTEKTFYKKVPNAEKMNEPKRLKKHLPQILKLLKPDDRILIVGTTRRPFDAELQSFCKVYQKII    631 - 700
LVPRPDYASRYVLWKQIIERNGGVLTSALNVSCLAKVTDGFTQGHIVEVVKGVLTDQRIRRQIHKPLTAV    701 - 770
EFITAITSMNPVYKEEEESFKNWYAKTPLGKKRALAITGGSTEKAKDKGKRK                      771 - 822
//

Publication (8)

PMID Year Title
23427265 2013 The N-DRC forms a conserved biochemical complex that maintains outer doublet alignment and limits microtubule sliding in motile axonemes.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
18466635 2008 The AAA+ superfamily of functionally diverse proteins.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.