Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.26
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.000 8.8e-04
Astrocytoma, Pilocytic -2.100 6.4e-07
Breast cancer -2.200 7.6e-08
chronic rhinosinusitis -1.842 4.9e-03
cystic fibrosis and chronic rhinosinusit... -1.239 4.1e-02
ependymoma 1.200 1.4e-04
facioscapulohumeral dystrophy 2.600 3.6e-04
glioblastoma -1.800 2.0e-04
group 3 medulloblastoma -1.400 2.6e-04
interstitial cystitis -1.300 6.8e-05
lung carcinoma -1.400 2.0e-08
nasopharyngeal carcinoma -2.000 1.0e-09
ovarian cancer -2.400 2.9e-05
pituitary cancer -1.700 1.4e-02

Gene RIF (1)

AA Sequence

MSNAMYNKMWHQTQEALGALLDKEPQKMIEPQRNQVFIFQTLATFYVKYVQIFRNLENVYDQFVHPQKRI      1 - 70
LIRKVLDGVMGRILELKNEMVELELTEFHYFDDILQDLKLAPQQLDIPIPKYFLKEKLEVIKGREKILAQ     71 - 140
ILADSGIDTSDMKYPVKSIPFDEAVKLIQIAERARQGRLRALFMKQIYLQEYRAKQSKMLGKKVTDTWAA    141 - 210
ALRIQKVWRRFHQRKETEKLREEEMIFLGMNPPPLFNEVSATVIQAEKVDRLRNEVQIKHEEDYREALVT    211 - 280
IKNDLKLIEGVDIKENLQDQIRHWFIECRNLTGTFPDYPDVEEGGSAIIFSDKTIQQVIEDIIANQEEEE    281 - 350
KNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEKWKMSPSLFLPAMKEGCNAYKEIWMKKDESWNFSQDYD    351 - 420
PELIKEEKRKELQSEIRIQVDELMRQELKNLKLAVDRERERPVKAGKKKDKKGKKGKKKEKKAKKDKDLT    421 - 490
ADRTIESLYKELVEEGLLIQALKVNLSDYIGEYSYLGTTLRQVSIEPMPSLLDVRQLITLYGIWPLGSAA    491 - 560
VHEKAPLVKSLLLAGPSGVGKKMLVHAICTETGANLFNLSSSNIAGKYPGKNGLQMMLHAVFKVARQLQP    561 - 630
SVVWIEDTEKTFYKKVPNAEKMNEPKRLKKHLPQILKLLKPDDRILIVGTTRRPFDAELQSFCKVYQKII    631 - 700
LVPRPDYASRYVLWKQIIERNGGVLTSALNVSCLAKVTDGFTQGHIVEVVKGVLTDQRIRRQIHKPLTAV    701 - 770
EFITAITSMNPVYKEEEESFKNWYAKTPLGKKRALAITGGSTEKAKDKGKRK                      771 - 822
//

Text Mined References (8)

PMID Year Title