Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
ulcerative colitis 2087 1.27701266110497E-6
atypical teratoid / rhabdoid tumor 4369 1.62345583447301E-6
active Crohn's disease 918 0.00325735035112664
medulloblastoma, large-cell 6234 0.00441281416380224


  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 0.000
medulloblastoma, large-cell -1.200 0.004
active Crohn's disease -1.492 0.003
ulcerative colitis -1.900 0.000


Accession Q86XF7 B4DX54


  Ortholog (8)

Gene RIF (1)

19773279 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

AWHRCSSCGQAFGQRRLLLLHQRSHHQVEHKGERD                                       211 - 245

Text Mined References (4)

PMID Year Title
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.