Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
active Crohn's disease -1.492 3.3e-03
active ulcerative colitis -1.559 3.3e-03
atypical teratoid / rhabdoid tumor -1.300 1.6e-06
medulloblastoma, large-cell -1.200 4.4e-03

Gene RIF (1)

AA Sequence

MLERGAESAAGATDPSPTGKEPVTKEAPHQGPPQKPSQSAPGPTASAGSPPRPRRRPPPQRPHRCPDCDK      1 - 70
AFSYPSKLATHRLAHGGARPHPCPDCPKAFSYPSKLAAHRLTHSGARPHPCPHCPKSFGHRSKLAAHLWT     71 - 140
HAPTRPYPCPDCPKSFCYPSKLAAHRHTHHATDARPYPCPHCPKAFSFPSKLAAHRLCHDPPTAPGSQAT    141 - 210
AWHRCSSCGQAFGQRRLLLLHQRSHHQVEHKGERD                                       211 - 245
//

Text Mined References (4)

PMID Year Title