Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.93
PubTator Score 4.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
cystic fibrosis 1.045 1.6e-03
gastric cancer 1.700 2.9e-03
hepatocellular carcinoma 1.900 3.0e-05
intraductal papillary-mucinous carcinoma... 1.300 4.7e-03
osteosarcoma -1.276 8.5e-03
ovarian cancer -1.400 6.3e-06
pancreatic cancer 1.600 9.9e-03
pancreatic carcinoma 1.600 9.9e-03
tuberculosis and treatment for 3 months -1.300 1.5e-02

Gene RIF (3)

AA Sequence

MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKD      1 - 70
RINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSSVYKEAMNHLGHLKLFVTRIM     71 - 140
QDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKFEVCEKDD                           141 - 187
//

Text Mined References (11)

PMID Year Title