Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.93
PubTator Score 4.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
gastric cancer 1.700 0.003
hepatocellular carcinoma 1.900 0.000
pancreatic cancer 1.600 0.010
osteosarcoma -1.276 0.009
cystic fibrosis 1.045 0.002
tuberculosis and treatment for 6 months -1.900 0.000
intraductal papillary-mucinous carcinoma... 1.300 0.005
pancreatic carcinoma 1.600 0.010
ovarian cancer -1.400 0.000

Synonym

Accession Q86XF0 D3DN30 Q6P4I9
Symbols DHFRL1
DHFRP4

Gene

PANTHER Protein Class (2)

Gene RIF (3)

PMID Text
24122410 We hope this work will be useful to understand the general characteristics of DHFRL1.
21876184 The DHFRP4, or dihydrofolate reductase-like 1 (DHFRL1), gene is expressed and shares some commonalities with DHFR.
18447718 The results of this study suggest that genetic variants of methionine metabolism are associated with meningioma formation

AA Sequence

MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKD      1 - 70
RINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSSVYKEAMNHLGHLKLFVTRIM     71 - 140
QDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKFEVCEKDD                           141 - 187
//

Text Mined References (10)

PMID Year Title
25980602 2015 An active second dihydrofolate reductase enzyme is not a feature of rat and mouse, but they do have activity in their mitochondria.
24122410 2013 Insight into the molecular mechanism about lowered dihydrofolate binding affinity to dihydrofolate reductase-like 1 (DHFRL1).
21876188 2011 Identification of a de novo thymidylate biosynthesis pathway in mammalian mitochondria.
21876184 2011 The former annotated human pseudogene dihydrofolate reductase-like 1 (DHFRL1) is expressed and functional.
18447718 2008 Polymorphisms of methionine metabolism and susceptibility to meningioma formation: laboratory investigation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.