Property Summary

NCBI Gene PubMed Count 10
Grant Count 6
R01 Count 6
Funding $838,458.01
PubMed Score 0.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
ependymoma -1.800 0.000
glioblastoma -1.800 0.000
group 3 medulloblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
medulloblastoma, large-cell -1.600 0.001
primitive neuroectodermal tumor -1.700 0.000
active Crohn's disease -1.274 0.022
diabetes mellitus 1.600 0.005
pediatric high grade glioma -1.700 0.000
pilocytic astrocytoma -1.700 0.000
lung carcinoma 1.300 0.000
Pick disease -1.500 0.000

AA Sequence

METYAEVGKEGKPSCASVDLQGDSSLQVEISDAVSERDKVKFTVQTKSCLPHFAQTEFSVVRQHEEFIWL      1 - 70
HDAYVENEEYAGLIIPPAPPRPDFEASREKLQKLGEGDSSVTREEFAKMKQELEAEYLAIFKKTVAMHEV     71 - 140
FLQRLAAHPTLRRDHNFFVFLEYGQDLSVRGKNRKELLGGFLRNIVKSADEALITGMSGLKEVDDFFEHE    141 - 210
RTFLLEYHTRIRDACLRADRVMRAHKCLADDYIPISAALSSLGTQEVNQLRTSFLKLAELFERLRKLEGR    211 - 280
VASDEDLKLSDMLRYYMRDSQAAKDLLYRRLRALADYENANKALDKARTRNREVRPAESHQQLCCQRFER    281 - 350
LSDSAKQELMDFKSRRVSSFRKNLIELAELELKHAKASTLILRNTLVALKGEP                     351 - 403
//

Text Mined References (11)

PMID Year Title
26172538 2015 Retromer Ensures the Degradation of Autophagic Cargo by Maintaining Lysosome Function in Drosophila.
25416956 2014 A proteome-scale map of the human interactome network.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
21516116 2011 Next-generation sequencing to generate interactome datasets.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16782399 2006 The Phox (PX) domain proteins and membrane traffic.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...