Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
active Crohn's disease -1.274 2.2e-02
adult high grade glioma -1.600 2.0e-04
Astrocytoma, Pilocytic -1.600 1.1e-07
atypical teratoid / rhabdoid tumor -1.300 7.8e-05
diabetes mellitus 1.200 2.0e-02
ependymoma -1.800 2.4e-16
glioblastoma -1.500 3.9e-10
group 3 medulloblastoma -2.000 3.0e-04
lung carcinoma 1.300 6.8e-09
medulloblastoma, large-cell -1.600 9.4e-04
Pick disease -1.500 2.8e-06
primitive neuroectodermal tumor -1.700 3.5e-04

AA Sequence

METYAEVGKEGKPSCASVDLQGDSSLQVEISDAVSERDKVKFTVQTKSCLPHFAQTEFSVVRQHEEFIWL      1 - 70
HDAYVENEEYAGLIIPPAPPRPDFEASREKLQKLGEGDSSVTREEFAKMKQELEAEYLAIFKKTVAMHEV     71 - 140
FLQRLAAHPTLRRDHNFFVFLEYGQDLSVRGKNRKELLGGFLRNIVKSADEALITGMSGLKEVDDFFEHE    141 - 210
RTFLLEYHTRIRDACLRADRVMRAHKCLADDYIPISAALSSLGTQEVNQLRTSFLKLAELFERLRKLEGR    211 - 280
VASDEDLKLSDMLRYYMRDSQAAKDLLYRRLRALADYENANKALDKARTRNREVRPAESHQQLCCQRFER    281 - 350
LSDSAKQELMDFKSRRVSSFRKNLIELAELELKHAKASTLILRNTLVALKGEP                     351 - 403
//

Text Mined References (11)

PMID Year Title