Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ependymoma 2514 2.38510904175223E-16
lung carcinoma 2844 6.8079487708261E-9
pilocytic astrocytoma 3086 6.70674365980447E-8
pediatric high grade glioma 2712 6.58200734330901E-7
Pick disease 1893 2.80958828256292E-6
glioblastoma 5572 7.45522138901443E-6
atypical teratoid / rhabdoid tumor 4369 7.80038170308719E-5
group 3 medulloblastoma 2254 3.01421958399538E-4
primitive neuroectodermal tumor 3031 3.54207967779352E-4
medulloblastoma, large-cell 6234 9.36796308552936E-4
diabetes mellitus 1663 0.00514748624394832
active Crohn's disease 918 0.0221878651806224
Disease Target Count Z-score Confidence
Breast cancer 3099 0.0 2.0

Expression

  Differential Expression (12)

Disease log2 FC p
ependymoma -1.800 0.000
glioblastoma -1.800 0.000
group 3 medulloblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
medulloblastoma, large-cell -1.600 0.001
primitive neuroectodermal tumor -1.700 0.000
active Crohn's disease -1.274 0.022
diabetes mellitus 1.600 0.005
pediatric high grade glioma -1.700 0.000
pilocytic astrocytoma -1.700 0.000
lung carcinoma 1.300 0.000
Pick disease -1.500 0.000

Synonym

Accession Q86XE0 Q8IW53 Q96NG4
Symbols SNX6B

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
C. elegans OMA EggNOG

AA Sequence

METYAEVGKEGKPSCASVDLQGDSSLQVEISDAVSERDKVKFTVQTKSCLPHFAQTEFSVVRQHEEFIWL      1 - 70
HDAYVENEEYAGLIIPPAPPRPDFEASREKLQKLGEGDSSVTREEFAKMKQELEAEYLAIFKKTVAMHEV     71 - 140
FLQRLAAHPTLRRDHNFFVFLEYGQDLSVRGKNRKELLGGFLRNIVKSADEALITGMSGLKEVDDFFEHE    141 - 210
RTFLLEYHTRIRDACLRADRVMRAHKCLADDYIPISAALSSLGTQEVNQLRTSFLKLAELFERLRKLEGR    211 - 280
VASDEDLKLSDMLRYYMRDSQAAKDLLYRRLRALADYENANKALDKARTRNREVRPAESHQQLCCQRFER    281 - 350
LSDSAKQELMDFKSRRVSSFRKNLIELAELELKHAKASTLILRNTLVALKGEP                     351 - 403
//

Text Mined References (11)

PMID Year Title
26172538 2015 Retromer Ensures the Degradation of Autophagic Cargo by Maintaining Lysosome Function in Drosophila.
25416956 2014 A proteome-scale map of the human interactome network.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
21516116 2011 Next-generation sequencing to generate interactome datasets.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16782399 2006 The Phox (PX) domain proteins and membrane traffic.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...