Property Summary

NCBI Gene PubMed Count 81
Grant Count 12
R01 Count 3
Funding $1,344,161.85
PubMed Score 204.03
PubTator Score 135.59

Knowledge Summary

Patent

No data available

Expression

 IMPC Term (1)

Gene RIF (66)

PMID Text
26893169 A STING-dependent, cGAS-independent pathway important for full interferon production and antiviral control of enveloped RNA viruses.
26867174 cGAS and STING are intracellular sensors that activate the interferon pathway in response to virus infection. [review]
26738286 STING(sv) inhibited the activity of the interferon (IFN)-beta promoter.
26603901 Studies indicate that the STING (stimulator of interferon genes)-controlled innate immune pathway has provided insight for treating autoinflammatory disease and cancer.
26593864 The study demonstrates the lack of association between the presence of systemic autoimmune diseases and mutations in exon 5 of the TMEM173 gene.
26471009 The cGAS-STING signaling pathway is required for not only the innate immune response against HBV but also the suppression of HBV assembly.
26468527 These results demonstrate a novel hepatitis C virus genotype-specific inhibition of the STING-mediated host antiviral immune response via the viral NS4B protein.
26315534 Studies suggest that the transmembrane protein 173 (STING) pathway is the main innate immune pathway involved in sensing of tumors, and its endogenous activation in APCs leads to subsequent T cell priming against tumor-associated antigens.
26311870 Knockout of cGAS and STING Rescues Virus Infection of Plasmid DNA-Transfected Cells.
26199418 Gammaherpesviruses encode inhibitors that block cGAS-STING-mediated antiviral immunity.
More...

AA Sequence

MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEEL      1 - 70
RHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLA     71 - 140
PAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPD    141 - 210
NLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFS    211 - 280
REDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSA    281 - 350
VPSTSTMSQEPELLISGMEKPLPLRTDFS                                             351 - 379
//

Text Mined References (90)

PMID Year Title
26893169 2016 Influenza A virus targets a cGAS-independent STING pathway that controls enveloped RNA viruses.
26867174 2016 The cGAS-STING Defense Pathway and Its Counteraction by Viruses.
26738286 2015 [Structure and Function of an Alternative Splicing Isoform of Stimulator of Interferon Genes STING(sv)].
26669264 2015 Rat and human STINGs profile similarly towards anticancer/antiviral compounds.
26603901 2015 STING: infection, inflammation and cancer.
26593864 2016 Sequence analysis of TMEM173 exon 5 in patients with systemic autoimmune diseases.
26471009 2016 The cyclic GMP-AMP synthetase-STING signaling pathway is required for both the innate immune response against HBV and the suppression of HBV assembly.
26468527 2015 Hepatitis C Virus NS4B Can Suppress STING Accumulation To Evade Innate Immune Responses.
26315534 2016 Endogenous and pharmacologic targeting of the STING pathway in cancer immunotherapy.
26311870 2015 Knockout of cGAS and STING Rescues Virus Infection of Plasmid DNA-Transfected Cells.
More...