Property Summary

NCBI Gene PubMed Count 113
PubMed Score 230.29
PubTator Score 135.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 1.215 1.7e-02
adrenocortical carcinoma -1.086 7.7e-04
adult high grade glioma 1.500 1.9e-04
Astrocytoma, Pilocytic 1.400 3.9e-06
atypical teratoid / rhabdoid tumor 1.400 2.2e-05
ependymoma 1.400 2.0e-08
gastric carcinoma 1.200 1.5e-02
glioblastoma 1.100 2.9e-06
intraductal papillary-mucinous neoplasm ... 1.500 5.2e-03
lung carcinoma -1.500 6.4e-30
medulloblastoma, large-cell 1.200 5.8e-04
non-small cell lung cancer -1.004 1.7e-10
osteosarcoma -1.156 9.2e-03
ovarian cancer 1.700 1.9e-07
pancreatic cancer 1.100 4.9e-04
primary pancreatic ductal adenocarcinoma 1.015 2.7e-02
Rheumatoid arthritis -1.300 2.3e-02
subependymal giant cell astrocytoma 1.156 1.3e-02
ulcerative colitis 1.800 6.0e-05

 IMPC Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (95)

AA Sequence

MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEEL      1 - 70
RHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLA     71 - 140
PAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPD    141 - 210
NLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFS    211 - 280
REDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSA    281 - 350
VPSTSTMSQEPELLISGMEKPLPLRTDFS                                             351 - 379
//

Text Mined References (122)

PMID Year Title