Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 4.9e-04
ependymoma 2.200 3.7e-09
glioblastoma 1.300 2.9e-05
group 3 medulloblastoma 1.700 8.8e-04
intraductal papillary-mucinous neoplasm ... 1.400 6.7e-03
pediatric high grade glioma 1.100 7.5e-04
psoriasis -1.400 1.4e-03

Gene RIF (1)

AA Sequence

MAGLSGAQIPDGEFTALVYRLIRDARYAEAVQLLGRELQRSPRSRAGLSLLGYCYYRLQEFALAAECYEQ      1 - 70
LGQLHPELEQYRLYQAQALYKACLYPEATRVAFLLLDNPAYHSRVLRLQAAIKYSEGDLPGSRSLVEQLL     71 - 140
SGEGGEESGGDNETDGQVNLGCLLYKEGQYEAACSKFSATLQASGYQPDLSYNLALAYYSSRQYASALKH    141 - 210
IAEIIERGIRQHPELGVGMTTEGFDVRSVGNTLVLHQTALVEAFNLKAAIEYQLRNYEVAQETLTDMPPR    211 - 280
AEEELDPVTLHNQALMNMDARPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLT    281 - 350
YKFLTPYLYDFLDALITCQTAPEEAFIKLDGLAGMLTEQLRRLTKQVQEARHNRDDEAIKKAVNEYDETM    351 - 420
EKYIPVLMAQAKIYWNLENYPMVEKVFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKHY    421 - 490
DNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDPNRKMYHLCIVNLVIGTLYCAKGNY    491 - 560
EFGISRVIKSLEPYNKKLGTDTWYYAKRCFLSLLENMSKHMIVIHDSVIQECVQFLGHCELYGTNIPAVI    561 - 630
EQPLEEERMHVGKNTVTDESRQLKALIYEIIGWNK                                       631 - 665
//

Text Mined References (6)

PMID Year Title