Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.38
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Synonym

Accession Q86WS3 E9PJA4 Q8N9U6
Symbols PLAC1L
TMEM122

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MALEVLMLLAVLIWTGAENLHVKISCSLDWLMVSVIPVAESRNLYIFADELHLGMGCPANRIHTYVYEFI      1 - 70
YLVRDCGIRTRVVSEETLLFQTELYFTPRNIDHDPQEIHLECSTSRKSVWLTPVSTENEIKLDPSPFIAD     71 - 140
FQTTAEELGLLSSSPNLL                                                        141 - 158
//

Text Mined References (4)

PMID Year Title