Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.38
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Synonym

Accession Q86WS3 E9PJA4 Q8N9U6
Symbols PLAC1L
TMEM122

Gene

AA Sequence

MALEVLMLLAVLIWTGAENLHVKISCSLDWLMVSVIPVAESRNLYIFADELHLGMGCPANRIHTYVYEFI      1 - 70
YLVRDCGIRTRVVSEETLLFQTELYFTPRNIDHDPQEIHLECSTSRKSVWLTPVSTENEIKLDPSPFIAD     71 - 140
FQTTAEELGLLSSSPNLL                                                        141 - 158
//

Text Mined References (4)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.