Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.38
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Synonym

Accession Q86WS3 E9PJA4 Q8N9U6
Symbols PLAC1L
TMEM122

Gene

AA Sequence

MALEVLMLLAVLIWTGAENLHVKISCSLDWLMVSVIPVAESRNLYIFADELHLGMGCPANRIHTYVYEFI      1 - 70
YLVRDCGIRTRVVSEETLLFQTELYFTPRNIDHDPQEIHLECSTSRKSVWLTPVSTENEIKLDPSPFIAD     71 - 140
FQTTAEELGLLSSSPNLL                                                        141 - 158
//

Publication (4)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.