Property Summary

NCBI Gene PubMed Count 13
PubMed Score 76.08
PubTator Score 28.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 3.8e-10
ovarian cancer 8520 3.3e-07
interstitial cystitis 2312 8.9e-05
Disease Target Count Z-score Confidence
Leishmaniasis 47 3.371 1.7
Sleeping sickness 37 3.066 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
interstitial cystitis -1.300 8.9e-05
osteosarcoma -3.425 3.8e-10
ovarian cancer -1.400 3.3e-07

Gene RIF (6)

AA Sequence

MAMAQKLSHLLPSLRQVIQEPQLSLQPEPVFTVDRAEVPPLFWKPYIYAGYRPLHQTWRFYFRTLFQQHN      1 - 70
EAVNVWTHLLAALVLLLRLALFVETVDFWGDPHALPLFIIVLASFTYLSFSALAHLLQAKSEFWHYSFFF     71 - 140
LDYVGVAVYQFGSALAHFYYAIEPAWHAQVQAVFLPMAAFLAWLSCIGSCYNKYIQKPGLLGRTCQEVPS    141 - 210
VLAYALDISPVVHRIFVSSDPTTDDPALLYHKCQVVFFLLAAAFFSTFMPERWFPGSCHVFGQGHQLFHI    211 - 280
FLVLCTLAQLEAVALDYEARRPIYEPLHTHWPHNFSGLFLLTVGSSILTAFLLSQLVQRKLDQKTK        281 - 346
//

Text Mined References (16)

PMID Year Title