Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.00
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
15905332 The authors present an overview of the LHFP gene family in mouse and humans
15620218 Expressed widely in ER of all tissues, especially highly in lung, thymus, skeleton muscle, colon and ovary.

AA Sequence

MRSSLTMVGTLWAFLSLVTAVTSSTSYFLPYWLFGSQMGKPVSFSTFRRCNYPVRGEGHSLIMVEECGRY      1 - 70
ASFNAIPSLAWQMCTVVTGAGCALLLLVALAAVLGCCMEELISRMMGRCMGAAQFVGGLLISSGCALYPL     71 - 140
GWNSPEIMQTCGNVSNQFQLGTCRLGWAYYCAGGGAAAAMLICTWLSCFAGRNPKPVILVESIMRNTNSY    141 - 210
AMELDHCLKP                                                                211 - 220
//

Text Mined References (9)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15905332 2005 A missense mutation in the previously undescribed gene Tmhs underlies deafness in hurry-scurry (hscy) mice.
15620218 2004 Isolation, tissue distribution and prokaryotic expression of a novel human X-linked gene LHFPL1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10329012 1999 LHFP, a novel translocation partner gene of HMGIC in a lipoma, is a member of a new family of LHFP-like genes.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.