Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.00
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MRSSLTMVGTLWAFLSLVTAVTSSTSYFLPYWLFGSQMGKPVSFSTFRRCNYPVRGEGHSLIMVEECGRY      1 - 70
ASFNAIPSLAWQMCTVVTGAGCALLLLVALAAVLGCCMEELISRMMGRCMGAAQFVGGLLISSGCALYPL     71 - 140
GWNSPEIMQTCGNVSNQFQLGTCRLGWAYYCAGGGAAAAMLICTWLSCFAGRNPKPVILVESIMRNTNSY    141 - 210
AMELDHCLKP                                                                211 - 220
//

Text Mined References (9)

PMID Year Title