Property Summary

NCBI Gene PubMed Count 16
Grant Count 4
R01 Count 4
Funding $388,058
PubMed Score 14.39
PubTator Score 4.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
glioblastoma -1.900 0.003
posterior fossa group A ependymoma -3.000 0.000
atypical teratoid / rhabdoid tumor -2.500 0.000
medulloblastoma, large-cell -2.100 0.000
pediatric high grade glioma -1.700 0.001
group 3 medulloblastoma -2.300 0.000
lung carcinoma 1.100 0.000
spina bifida 1.204 0.048

Synonym

Accession Q86WG3 Q8NAQ2 Q8TAQ3 Q96HC6 Q96JF5
Symbols CLAC
BNIP-H

Gene

Gene RIF (3)

PMID Text
23226316 Caytaxin's role in maintaining normal neuronal function
19861499 caytaxin binds to kinesin-1 and functions as an adaptor that mediates intracellular transport of specific cargos, one of which is the mitochondrion.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.

AA Sequence

MGTTEATLRMENVDVKEEWQDEDLPRPLPEETGVELLGSPVEDTSSPPNTLNFNGAHRKRKTLVAPEINI      1 - 70
SLDQSEGSLLSDDFLDTPDDLDINVDDIETPDETDSLEFLGNGNELEWEDDTPVATAKNMPGDSADLFGD     71 - 140
GTTEDGSAANGRLWRTVIIGEQEHRIDLHMIRPYMKVVTHGGYYGEGLNAIIVFAACFLPDSSLPDYHYI    141 - 210
MENLFLYVISSLELLVAEDYMIVYLNGATPRRRMPGIGWLKKCYQMIDRRLRKNLKSLIIVHPSWFIRTV    211 - 280
LAISRPFISVKFINKIQYVHSLEDLEQLIPMEHVQIPDCVLQYEEERLKARRESARPQPEFVLPRSEEKP    281 - 350
EVAPVENRSALVSEDQETSMS                                                     351 - 371
//

Publication (17)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
23226316 2012 Expression of Caytaxin protein in Cayman Ataxia mouse models correlates with phenotype severity.
21782286 2011 A genome-wide association study of aging.
21369758 2011 Cayman ataxia-related protein is a presynapse-specific caspase-3 substrate.
19861499 2009 Cayman ataxia protein caytaxin is transported by kinesin along neurites through binding to kinesin light chains.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
18628984 2008 Nerve growth factor stimulates interaction of Cayman ataxia protein BNIP-H/Caytaxin with peptidyl-prolyl isomerase Pin1 in differentiating neurons.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16899818 2006 Brain-specific BNIP-2-homology protein Caytaxin relocalises glutaminase to neurite terminals and reduces glutamate levels.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...