Property Summary

NCBI Gene PubMed Count 16
PubMed Score 14.39
PubTator Score 4.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.400 1.9e-03
atypical teratoid / rhabdoid tumor -2.500 2.7e-06
ependymoma -2.800 2.0e-16
glioblastoma -1.300 4.1e-03
group 3 medulloblastoma -2.300 4.8e-04
lung carcinoma 1.100 2.7e-17
medulloblastoma, large-cell -2.100 4.6e-04
spina bifida 1.204 4.8e-02

 GWAS Trait (1)

Gene RIF (3)

AA Sequence

MGTTEATLRMENVDVKEEWQDEDLPRPLPEETGVELLGSPVEDTSSPPNTLNFNGAHRKRKTLVAPEINI      1 - 70
SLDQSEGSLLSDDFLDTPDDLDINVDDIETPDETDSLEFLGNGNELEWEDDTPVATAKNMPGDSADLFGD     71 - 140
GTTEDGSAANGRLWRTVIIGEQEHRIDLHMIRPYMKVVTHGGYYGEGLNAIIVFAACFLPDSSLPDYHYI    141 - 210
MENLFLYVISSLELLVAEDYMIVYLNGATPRRRMPGIGWLKKCYQMIDRRLRKNLKSLIIVHPSWFIRTV    211 - 280
LAISRPFISVKFINKIQYVHSLEDLEQLIPMEHVQIPDCVLQYEEERLKARRESARPQPEFVLPRSEEKP    281 - 350
EVAPVENRSALVSEDQETSMS                                                     351 - 371
//

Text Mined References (17)

PMID Year Title