Property Summary

NCBI Gene PubMed Count 23
PubMed Score 21.35
PubTator Score 19.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute quadriplegic myopathy 1.351 4.4e-06
atypical teratoid / rhabdoid tumor -1.100 6.8e-03
dermatomyositis 1.100 8.8e-03
glioblastoma 1.200 3.5e-02
interstitial cystitis 1.100 6.2e-05
lung cancer -1.800 6.9e-05
medulloblastoma, large-cell -1.400 1.9e-04
osteosarcoma -1.340 9.2e-03
ovarian cancer -2.900 1.8e-10
Rheumatoid arthritis 1.300 2.1e-02
subependymal giant cell astrocytoma 1.716 4.2e-02

 GWAS Trait (1)

Gene RIF (14)

AA Sequence

MEPGPTAAQRRCSLPPWLPLGLLLWSGLALGALPFGSSPHRVFHDLLSEQQLLEVEDLSLSLLQGGGLGP      1 - 70
LSLPPDLPDLDPECRELLLDFANSSAELTGCLVRSARPVRLCQTCYPLFQQVVSKMDNISRAAGNTSESQ     71 - 140
SCARSLLMADRMQIVVILSEFFNTTWQEANCANCLTNNSEELSNSTVYFLNLFNHTLTCFEHNLQGNAHS    141 - 210
LLQTKNYSEVCKNCREAYKTLSSLYSEMQKMNELENKAEPGTHLCIDVEDAMNITRKLWSRTFNCSVPCS    211 - 280
DTVPVIAVSVFILFLPVVFYLSSFLHSEQKKRKLILPKRLKSSTSFANIQENSN                    281 - 334
//

Text Mined References (33)

PMID Year Title