Property Summary

NCBI Gene PubMed Count 22
PubMed Score 6.57
PubTator Score 13.86

Knowledge Summary

Patent (724)

Expression

  Differential Expression (18)

Gene RIF (13)

PMID Text
25300797 Two recurrent fusion genes associated with the 12q locus, LRP1-SNRNP25 and KCNMB4-CCND3, were by RT-PCR, Sanger sequencing and FISH, and were found to be osteosarcoma specific in a validation cohort of 240 other sarcomas.
25190810 BK channel beta4 subunit influences sensitivity and tolerance to alcohol by altering its response to kinases
24759175 Recombinant martentoxin selectively blocks KCNMA1/KCNMB4 channels.
24486049 Study shows that beta4 subunit of the MaxiK channel has no potential endocytic signal and 2 specific amino acids in the functional basic motif retention/retrieval trafficking signal at the C-terminus may play a role in controlling cellular excitability
24414257 IFN-gamma changed mRNA levels of the BK beta-modulatory proteins KCNMB2 (increased) and KCNMB4 (decreased) as well as leucine-rich repeat-containing protein (LRRC)26 (decreased).
23623847 our data suggest that the rs398702 variant in the KCNMB4 gene is unlikely to influence significantly the risk of developing mesial temporal lobe epilepsy or its severity
21848922 These results suggest that fast-gating, type I BK channels lacking beta4 can increase neuronal excitability in response to reduced phosphatase activity and activation of calcium channels.
19578543 results argue that, for native mouse Slo3 channels, the beta4 subunit must be considered as a potential interaction partner and, furthermore, that KCNMB subunits may have functions unrelated to regulation of the Slo1 alpha subunit
19204046 Report beta subunit (KNMB1-4)-specific modulations of BK channel function by a Slo1 mutation associated with epilepsy and dyskinesia.
18981408 The beta4 subunit controls ethanol tolerance at the molecular, cellular, and behavioral levels, and could determine individual differences in alcohol abuse and alcoholism, as well as represent a therapeutic target for alcoholism.
More...

AA Sequence

MAKLRVAYEYTEAEDKSIRLGLFLIISGVVSLFIFGFCWLSPALQDLQATEANCTVLSVQQIGEVFECTF      1 - 70
TCGADCRGTSQYPCVQVYVNNSESNSRALLHSDEHQLLTNPKCSYIPPCKRENQKNLESVMNWQQYWKDE     71 - 140
IGSQPFTCYFNQHQRPDDVLLHRTHDEIVLLHCFLWPLVTFVVGVLIVVLTICAKSLAVKAEAMKKRKFS    141 - 210
//

Text Mined References (23)

PMID Year Title
25561520 2015 Independent role for presynaptic FMRP revealed by an FMR1 missense mutation associated with intellectual disability and seizures.
25300797 2014 Recurrent LRP1-SNRNP25 and KCNMB4-CCND3 fusion genes promote tumor cell motility in human osteosarcoma.
25190810 2014 Large conductance voltage- and Ca2+-gated potassium (BK) channel ?4 subunit influences sensitivity and tolerance to alcohol by altering its response to kinases.
24759175 2014 Recombinant expression and functional characterization of martentoxin: a selective inhibitor for BK channel (? + ?4).
24486049 2014 An endoplasmic reticulum trafficking signal regulates surface expression of ?4 subunit of a voltage- and Ca²?-activated K? channel.
24414257 2014 IFN-?-mediated reduction of large-conductance, Ca2+-activated, voltage-dependent K+ (BK) channel activity in airway epithelial cells leads to mucociliary dysfunction.
23623847 2013 Failure to confirm association of a polymorphism in KCNMB4 gene with mesial temporal lobe epilepsy.
21848922 2011 Modulation by the BK accessory ?4 subunit of phosphorylation-dependent changes in excitability of dentate gyrus granule neurons.
19578543 2009 Interactions between beta subunits of the KCNMB family and Slo3: beta4 selectively modulates Slo3 expression and function.
19204046 2009 {beta} subunit-specific modulations of BK channel function by a mutation associated with epilepsy and dyskinesia.
More...