Property Summary

NCBI Gene PubMed Count 22
PubMed Score 8.05
PubTator Score 13.86

Knowledge Summary

Patent (724)

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.300 1.3e-04
astrocytic glioma -1.400 3.1e-02
atypical teratoid / rhabdoid tumor -1.900 4.3e-04
ependymoma -2.100 2.6e-02
glioblastoma -1.300 5.5e-05
group 3 medulloblastoma -1.200 7.2e-03
intraductal papillary-mucinous adenoma (... -1.200 1.6e-03
intraductal papillary-mucinous carcinoma... -1.200 5.1e-05
lung adenocarcinoma -1.200 1.0e-06
lung cancer -1.500 6.5e-03
lung carcinoma -1.100 1.0e-06
medulloblastoma, large-cell -2.100 5.2e-05
non-small cell lung carcinoma -1.400 1.2e-18
oligodendroglioma -1.500 2.4e-02
pituitary cancer -1.600 6.5e-06
primitive neuroectodermal tumor -1.300 1.5e-04
psoriasis -1.400 1.4e-83
subependymal giant cell astrocytoma -1.889 3.4e-02

Gene RIF (13)

AA Sequence

MAKLRVAYEYTEAEDKSIRLGLFLIISGVVSLFIFGFCWLSPALQDLQATEANCTVLSVQQIGEVFECTF      1 - 70
TCGADCRGTSQYPCVQVYVNNSESNSRALLHSDEHQLLTNPKCSYIPPCKRENQKNLESVMNWQQYWKDE     71 - 140
IGSQPFTCYFNQHQRPDDVLLHRTHDEIVLLHCFLWPLVTFVVGVLIVVLTICAKSLAVKAEAMKKRKFS    141 - 210
//

Text Mined References (23)

PMID Year Title