Property Summary

NCBI Gene PubMed Count 13
PubMed Score 57.88
PubTator Score 9.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
BEAULIEU-BOYCOTT-INNES SYNDROME 1 0.0 0.0
Disease Target Count P-value
malignant mesothelioma 3232 3.6e-06
group 3 medulloblastoma 4104 1.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 4.0
Disease Target Count Z-score Confidence
Kernicterus 11 3.059 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.400 1.1e-02
malignant mesothelioma 1.700 3.6e-06

 GO Function (1)

Gene RIF (7)

AA Sequence

MERAVPLAVPLGQTEVFQALQRLHMTIFSQSVSPCGKFLAAGNNYGQIAIFSLSSALSSEAKEESKKPVV      1 - 70
TFQAHDGPVYSMVSTDRHLLSAGDGEVKAWLWAEMLKKGCKELWRRQPPYRTSLEVPEINALLLVPKENS     71 - 140
LILAGGDCQLHTMDLETGTFTRVLRGHTDYIHCLALRERSPEVLSGGEDGAVRLWDLRTAKEVQTIEVYK    141 - 210
HEECSRPHNGRWIGCLATDSDWMVCGGGPALTLWHLRSSTPTTIFPIRAPQKHVTFYQDLILSAGQGRCV    211 - 280
NQWQLSGELKAQVPGSSPGLLSLSLNQQPAAPECKVLTAAGNSCRVDVFTNLGYRAFSLSF             281 - 341
//

Text Mined References (16)

PMID Year Title