Property Summary

NCBI Gene PubMed Count 13
Grant Count 7
R01 Count 2
Funding $397,791.75
PubMed Score 21.29
PubTator Score 11.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Carcinoma 2,147 1.0

Gene RIF (8)

PMID Text
23562614 Review summarize recent advances of the role of of human and murine NLRP10 in innate and adaptive immune responses. [Review]
22672233 These data revealed a novel role of NLRP10 in innate immune responses towards bacterial infection and suggest that NLRP10 functions as a scaffold for the formation of the NOD1-Nodosome.
22365966 The results show that either deletion of the p53 binding elements within the PYNOD promoter or treatment with p53 inhibitor could significantly reduce PYNOD promoter activity.
20403135 Observational study of gene-disease association. (HuGE Navigator)
20393137 Transgenic PYNOD colocalizes with apoptosis-associated speck-like protein containing a caspase recruitment domain (ASC) and inhibits caspase-1-mediated interleukin (IL)-1beta processing without inhibiting caspase-4-mediated caspase-1 processing.
19544093 The structural modification of the NLRP10 gene might have played a role in development or enhancement of human-specific traits during evolution.
15817483 PYPAF3 is a feedback regulator of interleukin-1beta secretion, and PYPAF2 and PYPAF3, together with PYNOD, constitute an anti-inflammatory subgroup of PYRIN-containing apoptotic protease-activating factor-1-like proteins
15096476 PYNOD is a novel regulator of apoptosis and inflammation.

AA Sequence

MAMAKARKPREALLWALSDLEENDFKKLKFYLRDMTLSEGQPPLARGELEGLIPVDLAELLISKYGEKEA      1 - 70
VKVVLKGLKVMNLLELVDQLSHICLHDYREVYREHVRCLEEWQEAGVNGRYNQVLLVAKPSSESPESLAC     71 - 140
PFPEQELESVTVEALFDSGEKPSLAPSLVVLQGSAGTGKTTLARKMVLDWATGTLYPGRFDYVFYVSCKE    141 - 210
VVLLLESKLEQLLFWCCGDNQAPVTEILRQPERLLFILDGFDELQRPFEEKLKKRGLSPKESLLHLLIRR    211 - 280
HTLPTCSLLITTRPLALRNLEPLLKQARHVHILGFSEEERARYFSSYFTDEKQADRAFDIVQKNDILYKA    281 - 350
CQVPGICWVVCSWLQGQMERGKVVLETPRNSTDIFMAYVSTFLPPDDDGGCSELSRHRVLRSLCSLAAEG    351 - 420
IQHQRFLFEEAELRKHNLDGPRLAAFLSSNDYQLGLAIKKFYSFRHISFQDFFHAMSYLVKEDQSRLGKE    421 - 490
SRREVQRLLEVKEQEGNDEMTLTMQFLLDISKKDSFSNLELKFCFRISPCLAQDLKHFKEQMESMKHNRT    491 - 560
WDLEFSLYEAKIKNLVKGIQMNNVSFKIKHSNEKKSQSQNLFSVKSSLSHGPKEEQKCPSVHGQKEGKDN    561 - 630
IAGTQKEASTGKGRGTEETPKNTYI                                                 631 - 655
//

Text Mined References (14)

PMID Year Title
23562614 2013 Roles of NLRP10 in innate and adaptive immunity.
23042114 2012 Genome-wide association study identifies eight new susceptibility loci for atopic dermatitis in the Japanese population.
22672233 2012 NLRP10 enhances Shigella-induced pro-inflammatory responses.
22618865 2013 ¹H, ¹³C and ¹?N resonance assignments of the pyrin domain from human PYNOD.
22365966 2012 Functional characterization of the p53 binding site in the human PYNOD promoter.
20403135 2010 The genetics of NOD-like receptors in Crohn's disease.
20393137 2010 Anti-inflammatory activity of PYNOD and its mechanism in humans and mice.
19544093 2009 A 2.7-kb deletion in the human NLRP10 gene exon 2 occurred after the human-chimpanzee divergence.
15817483 2005 PYPAF3, a PYRIN-containing APAF-1-like protein, is a feedback regulator of caspase-1-dependent interleukin-1beta secretion.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...