Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.23
PubTator Score 1.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Gene RIF (1)

PMID Text
18976975 Knockdown of low density lipoprotein receptor-related protein 11 (LRP11) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MASVAQESAGSQRRLPPRHGALRGLLLLCLWLPSGRAALPPAAPLSELHAQLSGVEQLLEEFRRQLQQER      1 - 70
PQEELELELRAGGGPQEDCPGPGSGGYSAMPDAIIRTKDSLAAGASFLRAPAAVRGWRQCVAACCSEPRC     71 - 140
SVAVVELPRRPAPPAAVLGCYLFNCTARGRNVCKFALHSGYSSYSLSRAPDGAALATARASPRQEKDAPP    141 - 210
LSKAGQDVVLHLPTDGVVLDGRESTDDHAIVQYEWALLQGDPSVDMKVPQSGTLKLSHLQEGTYTFQLTV    211 - 280
TDTAGQRSSDNVSVTVLRAAYSTGGCLHTCSRYHFFCDDGCCIDITLACDGVQQCPDGSDEDFCQNLGLD    281 - 350
RKMVTHTAASPALPRTTGPSEDAGGDSLVEKSQKATAPNKPPALSNTEKRNHSAFWGPESQIIPVMPDSS    351 - 420
SSGKNRKEESYIFESKGDGGGGEHPAPETGAVLPLALGLAITALLLLMVACRLRLVKQKLKKARPITSEE    421 - 490
SDYLINGMYL                                                                491 - 500
//

Text Mined References (6)

PMID Year Title
17620599 2007 Functional specialization of beta-arrestin interactions revealed by proteomic analysis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.