Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.15
PubTator Score 1.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute quadriplegic myopathy 2.079 6.8e-08
adult high grade glioma -1.600 2.0e-03
astrocytic glioma -2.200 3.9e-03
Astrocytoma, Pilocytic -1.200 3.0e-04
atypical teratoid / rhabdoid tumor -1.500 3.0e-05
autosomal dominant Emery-Dreifuss muscul... 1.154 1.7e-03
ependymoma -1.400 2.3e-02
glioblastoma -1.300 1.1e-04
group 4 medulloblastoma -1.500 1.3e-03
interstitial cystitis -1.300 3.2e-04
juvenile dermatomyositis 1.182 3.3e-10
lung carcinoma 1.100 1.4e-20
medulloblastoma, large-cell -2.100 2.2e-05
nasopharyngeal carcinoma -2.100 1.3e-04
oligodendroglioma -1.300 3.3e-02
ovarian cancer -2.700 1.5e-06
primary pancreatic ductal adenocarcinoma 1.016 6.9e-03
primitive neuroectodermal tumor -1.300 5.4e-04
spina bifida -1.461 2.4e-02

Gene RIF (1)

AA Sequence

MASVAQESAGSQRRLPPRHGALRGLLLLCLWLPSGRAALPPAAPLSELHAQLSGVEQLLEEFRRQLQQER      1 - 70
PQEELELELRAGGGPQEDCPGPGSGGYSAMPDAIIRTKDSLAAGASFLRAPAAVRGWRQCVAACCSEPRC     71 - 140
SVAVVELPRRPAPPAAVLGCYLFNCTARGRNVCKFALHSGYSSYSLSRAPDGAALATARASPRQEKDAPP    141 - 210
LSKAGQDVVLHLPTDGVVLDGRESTDDHAIVQYEWALLQGDPSVDMKVPQSGTLKLSHLQEGTYTFQLTV    211 - 280
TDTAGQRSSDNVSVTVLRAAYSTGGCLHTCSRYHFFCDDGCCIDITLACDGVQQCPDGSDEDFCQNLGLD    281 - 350
RKMVTHTAASPALPRTTGPSEDAGGDSLVEKSQKATAPNKPPALSNTEKRNHSAFWGPESQIIPVMPDSS    351 - 420
SSGKNRKEESYIFESKGDGGGGEHPAPETGAVLPLALGLAITALLLLMVACRLRLVKQKLKKARPITSEE    421 - 490
SDYLINGMYL                                                                491 - 500
//

Text Mined References (6)

PMID Year Title