Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.80
PubTator Score 12.51

Knowledge Summary

Patent (1,807)

Expression

  Differential Expression (7)

Disease log2 FC p
ductal carcinoma in situ 1.100 3.1e-02
interstitial cystitis 2.000 1.5e-03
osteosarcoma -4.794 4.5e-09
periodontitis 1.300 5.9e-24
primary Sjogren syndrome 1.700 1.6e-03
psoriasis 1.500 2.9e-59
ulcerative colitis 2.000 1.5e-04

Gene RIF (7)

AA Sequence

MQVPNSTGPDNATLQMLRNPAIAVALPVVYSLVAAVSIPGNLFSLWVLCRRMGPRSPSVIFMINLSVTDL      1 - 70
MLASVLPFQIYYHCNRHHWVFGVLLCNVVTVAFYANMYSSILTMTCISVERFLGVLYPLSSKRWRRRRYA     71 - 140
VAACAGTWLLLLTALSPLARTDLTYPVHALGIITCFDVLKWTMLPSVAMWAVFLFTIFILLFLIPFVITV    141 - 210
ACYTATILKLLRTEEAHGREQRRRAVGLAAVVLLAFVTCFAPNNFVLLAHIVSRLFYGKSYYHVYKLTLC    211 - 280
LSCLNNCLDPFVYYFASREFQLRLREYLGCRRVPRDTLDTRRESLFSARTTSVRSEAGAHPEGMEGATRP    281 - 350
GLQRQESVF                                                                 351 - 359
//

Text Mined References (14)

PMID Year Title