Tbio | P2Y purinoceptor 8 |
Probable receptor for purines coupled to G-proteins.
The protein encoded by this gene belongs to the family of G-protein coupled receptors, that are preferentially activated by adenosine and uridine nucleotides. This gene is moderately expressed in undifferentiated HL60 cells, and is located on both chromosomes X and Y. [provided by RefSeq, Jul 2008]
The protein encoded by this gene belongs to the family of G-protein coupled receptors, that are preferentially activated by adenosine and uridine nucleotides. This gene is moderately expressed in undifferentiated HL60 cells, and is located on both chromosomes X and Y. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count |
---|---|
Precursor Cell Lymphoblastic Leukemia Lymphoma | 42 |
Disease | Target Count | P-value |
---|---|---|
psoriasis | 6685 | 2.91393533776901E-59 |
periodontitis | 269 | 5.919053452993E-24 |
osteosarcoma | 7933 | 4.46047425733044E-9 |
interstitial cystitis | 2299 | 3.21882479460167E-5 |
ulcerative colitis | 2087 | 1.52998039884198E-4 |
primary Sjogren syndrome | 789 | 0.00157956314066646 |
ductal carcinoma in situ | 1745 | 0.0313244542607348 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
acute lymphocytic leukemia | 25 | 4.314 | 2.2 |
Down syndrome | 548 | 4.278 | 2.1 |
interleukin-7 receptor alpha deficiency | 16 | 3.212 | 1.6 |
Disease | log2 FC | p |
---|---|---|
osteosarcoma | -4.794 | 0.000 |
periodontitis | 1.300 | 0.000 |
interstitial cystitis | 2.100 | 0.000 |
primary Sjogren syndrome | 1.700 | 0.002 |
ductal carcinoma in situ | 1.100 | 0.031 |
ulcerative colitis | 2.000 | 0.000 |
psoriasis | 1.500 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Dog | OMA EggNOG |
Cow | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Chicken | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG |
Xenopus | OMA EggNOG |
Zebrafish | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
26573295 | P2RY8 promotes clustering of activated B cells within follicles in a follicular dendritic cell (FDC)-dependent manner. |
23091296 | P2RY8-CRLF2-positive clones do not have the necessary proliferative or selective advantage to evolve into a disease-relevant relapse clone. |
22484421 | Poor prognosis for P2RY8-CRLF2 fusion but not for CRLF2 over-expression in children with intermediate risk B-cell precursor acute lymphoblastic leukemia. |
20378752 | Study reports an extremely high incidence of relapse (71% +/- 19%) in non-high-risk precursor B-cell acute lymphoblastic leukemia patients with P2RY8-CRLF2 rearrangement. |
17554380 | SOX5 is upregulated by promoter swapping with the P2RY8 gene in primary splenic follicular lymphoma |
17487742 | P2RY8 is expressed in leukemic cells and has an unexpected role in the pathogenesis of acute leukemia |
MQVPNSTGPDNATLQMLRNPAIAVALPVVYSLVAAVSIPGNLFSLWVLCRRMGPRSPSVIFMINLSVTDL 1 - 70 MLASVLPFQIYYHCNRHHWVFGVLLCNVVTVAFYANMYSSILTMTCISVERFLGVLYPLSSKRWRRRRYA 71 - 140 VAACAGTWLLLLTALSPLARTDLTYPVHALGIITCFDVLKWTMLPSVAMWAVFLFTIFILLFLIPFVITV 141 - 210 ACYTATILKLLRTEEAHGREQRRRAVGLAAVVLLAFVTCFAPNNFVLLAHIVSRLFYGKSYYHVYKLTLC 211 - 280 LSCLNNCLDPFVYYFASREFQLRLREYLGCRRVPRDTLDTRRESLFSARTTSVRSEAGAHPEGMEGATRP 281 - 350 GLQRQESVF 351 - 359 //
PMID | Year | Title |
---|---|---|
26573295 | 2015 | The G protein-coupled receptor P2RY8 and follicular dendritic cells promote germinal center confinement of B cells, whereas S1PR3 can contribute to their dissemination. |
23091296 | 2012 | Small sizes and indolent evolutionary dynamics challenge the potential role of P2RY8-CRLF2-harboring clones as main relapse-driving force in childhood ALL. |
22484421 | 2012 | Poor prognosis for P2RY8-CRLF2 fusion but not for CRLF2 over-expression in children with intermediate risk B-cell precursor acute lymphoblastic leukemia. |
20378752 | 2010 | Presence of the P2RY8-CRLF2 rearrangement is associated with a poor prognosis in non-high-risk precursor B-cell acute lymphoblastic leukemia in children treated according to the ALL-BFM 2000 protocol. |
19349973 | 2009 | Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins. |
17554380 | 2007 | Upregulation of the SOX5 by promoter swapping with the P2RY8 gene in primary splenic follicular lymphoma. |
17487742 | 2007 | Transforming activity of purinergic receptor P2Y, G protein coupled, 8 revealed by retroviral expression screening. |
15772651 | 2005 | The DNA sequence of the human X chromosome. |
15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
15466006 | 2004 | Disruption of a new X linked gene highly expressed in brain in a family with two mentally retarded males. |
More... |