Property Summary

NCBI Gene PubMed Count 12
Grant Count 2
R01 Count 2
Funding $118,718.83
PubMed Score 7.92
PubTator Score 12.51

Knowledge Summary

Patent (1,807)

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -4.794 0.000
periodontitis 1.300 0.000
interstitial cystitis 2.100 0.000
primary Sjogren syndrome 1.700 0.002
ductal carcinoma in situ 1.100 0.031
ulcerative colitis 2.000 0.000
psoriasis 1.500 0.000

Gene RIF (6)

PMID Text
26573295 P2RY8 promotes clustering of activated B cells within follicles in a follicular dendritic cell (FDC)-dependent manner.
23091296 P2RY8-CRLF2-positive clones do not have the necessary proliferative or selective advantage to evolve into a disease-relevant relapse clone.
22484421 Poor prognosis for P2RY8-CRLF2 fusion but not for CRLF2 over-expression in children with intermediate risk B-cell precursor acute lymphoblastic leukemia.
20378752 Study reports an extremely high incidence of relapse (71% +/- 19%) in non-high-risk precursor B-cell acute lymphoblastic leukemia patients with P2RY8-CRLF2 rearrangement.
17554380 SOX5 is upregulated by promoter swapping with the P2RY8 gene in primary splenic follicular lymphoma
17487742 P2RY8 is expressed in leukemic cells and has an unexpected role in the pathogenesis of acute leukemia

AA Sequence

MQVPNSTGPDNATLQMLRNPAIAVALPVVYSLVAAVSIPGNLFSLWVLCRRMGPRSPSVIFMINLSVTDL      1 - 70
MLASVLPFQIYYHCNRHHWVFGVLLCNVVTVAFYANMYSSILTMTCISVERFLGVLYPLSSKRWRRRRYA     71 - 140
VAACAGTWLLLLTALSPLARTDLTYPVHALGIITCFDVLKWTMLPSVAMWAVFLFTIFILLFLIPFVITV    141 - 210
ACYTATILKLLRTEEAHGREQRRRAVGLAAVVLLAFVTCFAPNNFVLLAHIVSRLFYGKSYYHVYKLTLC    211 - 280
LSCLNNCLDPFVYYFASREFQLRLREYLGCRRVPRDTLDTRRESLFSARTTSVRSEAGAHPEGMEGATRP    281 - 350
GLQRQESVF                                                                 351 - 359
//

Publication (13)

PMID Year Title
26573295 2015 The G protein-coupled receptor P2RY8 and follicular dendritic cells promote germinal center confinement of B cells, whereas S1PR3 can contribute to their dissemination.
23091296 2012 Small sizes and indolent evolutionary dynamics challenge the potential role of P2RY8-CRLF2-harboring clones as main relapse-driving force in childhood ALL.
22484421 2012 Poor prognosis for P2RY8-CRLF2 fusion but not for CRLF2 over-expression in children with intermediate risk B-cell precursor acute lymphoblastic leukemia.
20378752 2010 Presence of the P2RY8-CRLF2 rearrangement is associated with a poor prognosis in non-high-risk precursor B-cell acute lymphoblastic leukemia in children treated according to the ALL-BFM 2000 protocol.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
17554380 2007 Upregulation of the SOX5 by promoter swapping with the P2RY8 gene in primary splenic follicular lymphoma.
17487742 2007 Transforming activity of purinergic receptor P2Y, G protein coupled, 8 revealed by retroviral expression screening.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466006 2004 Disruption of a new X linked gene highly expressed in brain in a family with two mentally retarded males.
More...