Property Summary

NCBI Gene PubMed Count 6
PubMed Score 410.99
PubTator Score 3.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Iron Metabolism Disorders 5 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 2.8e-09
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Space motion sickness 3 3.346 1.7
Syringomyelia 15 3.175 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 2.8e-09

Gene RIF (1)

AA Sequence

MATDMQRKRSSECLDGTLTPSDGQSMERAESPTPGMAQGMEPGAGQEGAMFVHARSYEDLTESEDGAASG      1 - 70
DSHKEGTRGPPPLPTDMRQISQDFSELSTQLTGVARDLQEEMLPGSSEDWLEPPGAVGRPATEPPREGTT     71 - 140
EGDEEDATEAWRLHQKHVFVLSEAGKPVYSRYGSEEALSSTMGVMVALVSFLEADKNAIRSIHADGYKVV    141 - 210
FVRRSPLVLVAVARTRQSAQELAQELLYIYYQILSLLTGAQLSHIFQQKQNYDLRRLLSGSERITDNLLQ    211 - 280
LMARDPSFLMGAARCLPLAAAVRDTVSASLQQARARSLVFSILLARNQLVALVRRKDQFLHPIDLHLLFN    281 - 350
LISSSSSFREGEAWTPVCLPKFNAAGFFHAHISYLEPDTDLCLLLVSTDREDFFAVSDCRRRFQERLRKR    351 - 420
GAHLALREALRTPYYSVAQVGIPDLRHFLYKSKSSGLFTSPEIEAPYTSEEEQERLLGLYQYLHSRAHNA    421 - 490
SRPLKTIYYTGPNENLLAWVTGAFELYMCYSPLGTKASAVSAIHKLMRWIRKEEDRLFILTPLTY         491 - 555
//

Text Mined References (12)

PMID Year Title