Property Summary

NCBI Gene PubMed Count 17
PubMed Score 26.52
PubTator Score 21.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Juvenile arthritis 124
Disease Target Count P-value
nasopharyngeal carcinoma 1056 1.81106267968107E-8
osteosarcoma 7933 2.28124226889387E-8
tuberculosis 1563 4.62174986173064E-4
group 3 medulloblastoma 2254 0.0021272827195854
pancreatic cancer 2300 0.0079328947387005
pancreatic carcinoma 567 0.0079328947387005
uncontrolled asthma 67 0.0188244718047043
Disease Target Count Z-score Confidence
Systemic primary carnitine deficiency disease 16 3.287 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
pancreatic cancer 1.500 0.008
uncontrolled asthma 1.100 0.019
osteosarcoma -4.797 0.000
tuberculosis 1.200 0.000
group 3 medulloblastoma 1.700 0.002
pancreatic carcinoma 1.500 0.008
nasopharyngeal carcinoma -1.800 0.000

Synonym

Accession Q86VW1 O14567 Q5JXM1 Q8IUG8 Q8IZD5 Q96M90 Q96RU0
Symbols CT2
OAT6
OCT6
OKB1
FLIPT2
HEL-S-18
dJ261K5.1

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 CSPA Cell Line (2)

Gene RIF (16)

PMID Text
26499074 findings may greatly contribute to the elucidation of the roles of the Oct and Myc proteins in osteoblast direct reprogramming. The results may also lead to establishment of novel regenerative therapy for various bone resorption diseases
26314988 Deletions in SLC22A16, a doxorubicin transporter, are associated with a failure to achieve event free survival in immunochemotherapy-treated diffuse large B-cell lymphoma.
25998464 Knockdown of CT2 reduced the growth and viability of acute myeloid leukemia cells with high expression of CT2 (OCI-AML2 and HL60), but not low expression. CT2 knockdown reduced basal oxygen consumption without a concomitant increase in glycolysis.
25772757 Both gene and protein expression of OCT6 were decreased in both CDDP-resistant lung cancer cell lines compared with their expression in their respective parental cells.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20179710 Variant alleles in the ABCB1, SLC22A16 and CYP2B6 genes are associated with response to AC therapy in the treatment of breast cancer.
20179710 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20037140 that hCT2 can mediate bleomycin-A5 and polyamine uptake, and that the rate of bleomycin-A5 accumulation may account for the differential response to the drug in patients.
17581421 SLC22A16 was abundantly expressed in clear-cell adenocarcinomaof the ovary.
17559346 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MGSRHFEGIYDHVGHFGRFQRVLYFICAFQNISCGIHYLASVFMGVTPHHVCRPPGNVSQVVFHNHSNWS      1 - 70
LEDTGALLSSGQKDYVTVQLQNGEIWELSRCSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTA     71 - 140
VTQWNLVCDRKWLAMLIQPLFMFGVLLGSVTFGYFSDRLGRRVVLWATSSSMFLFGIAAAFAVDYYTFMA    141 - 210
ARFFLAMVASGYLVVGFVYVMEFIGMKSRTWASVHLHSFFAVGTLLVALTGYLVRTWWLYQMILSTVTVP    211 - 280
FILCCWVLPETPFWLLSEGRYEEAQKIVDIMAKWNRASSCKLSELLSLDLQGPVSNSPTEVQKHNLSYLF    281 - 350
YNWSITKRTLTVWLIWFTGSLGFYSFSLNSVNLGGNEYLNLFLLGVVEIPAYTFVCIAMDKVGRRTVLAY    351 - 420
SLFCSALACGVVMVIPQKHYILGVVTAMVGKFAIGAAFGLIYLYTAELYPTIVRSLAVGSGSMVCRLASI    421 - 490
LAPFSVDLSSIWIFIPQLFVGTMALLSGVLTLKLPETLGKRLATTWEEAAKLESENESKSSKLLLTTNNS    491 - 560
GLEKTEAITPRDSGLGE                                                         561 - 577
//

Text Mined References (19)

PMID Year Title
26499074 2015 Transduction of Oct6 or Oct9 gene concomitant with Myc family gene induced osteoblast-like phenotypic conversion in normal human fibroblasts.
26314988 2015 Whole-exome analysis reveals novel somatic genomic alterations associated with outcome in immunochemotherapy-treated diffuse large B-cell lymphoma.
25998464 2015 Carnitine transporter CT2 (SLC22A16) is over-expressed in acute myeloid leukemia (AML) and target knockdown reduces growth and viability of AML cells.
25772757 2015 Organic cation transporter OCT6 mediates cisplatin uptake and resistance to cisplatin in lung cancer.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20179710 2010 Influence of pharmacogenetics on response and toxicity in breast cancer patients treated with doxorubicin and cyclophosphamide.
20037140 2010 The human carnitine transporter SLC22A16 mediates high affinity uptake of the anticancer polyamine analogue bleomycin-A5.
17581421 2007 Expression of organic cation transporter SLC22A16 in human epithelial ovarian cancer: a possible role of the adriamycin importer.
17559346 2007 Novel SLC22A16 polymorphisms and influence on doxorubicin pharmacokinetics in Asian breast cancer patients.
17473959 2007 Polyspecific organic cation transporters: structure, function, physiological roles, and biopharmaceutical implications.
More...