Property Summary

NCBI Gene PubMed Count 18
PubMed Score 25.43
PubTator Score 21.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Arthritis, Juvenile 126 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Systemic primary carnitine deficiency disease 15 3.364 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
group 3 medulloblastoma 1.600 1.8e-02
nasopharyngeal carcinoma -1.800 1.8e-08
osteosarcoma -4.380 6.0e-06
pancreatic cancer 1.500 7.9e-03
pancreatic carcinoma 1.500 7.9e-03
tuberculosis 1.200 4.6e-04
uncontrolled asthma 1.100 1.9e-02

Gene RIF (17)

AA Sequence

MGSRHFEGIYDHVGHFGRFQRVLYFICAFQNISCGIHYLASVFMGVTPHHVCRPPGNVSQVVFHNHSNWS      1 - 70
LEDTGALLSSGQKDYVTVQLQNGEIWELSRCSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTA     71 - 140
VTQWNLVCDRKWLAMLIQPLFMFGVLLGSVTFGYFSDRLGRRVVLWATSSSMFLFGIAAAFAVDYYTFMA    141 - 210
ARFFLAMVASGYLVVGFVYVMEFIGMKSRTWASVHLHSFFAVGTLLVALTGYLVRTWWLYQMILSTVTVP    211 - 280
FILCCWVLPETPFWLLSEGRYEEAQKIVDIMAKWNRASSCKLSELLSLDLQGPVSNSPTEVQKHNLSYLF    281 - 350
YNWSITKRTLTVWLIWFTGSLGFYSFSLNSVNLGGNEYLNLFLLGVVEIPAYTFVCIAMDKVGRRTVLAY    351 - 420
SLFCSALACGVVMVIPQKHYILGVVTAMVGKFAIGAAFGLIYLYTAELYPTIVRSLAVGSGSMVCRLASI    421 - 490
LAPFSVDLSSIWIFIPQLFVGTMALLSGVLTLKLPETLGKRLATTWEEAAKLESENESKSSKLLLTTNNS    491 - 560
GLEKTEAITPRDSGLGE                                                         561 - 577
//

Text Mined References (20)

PMID Year Title