Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non-small cell lung carcinoma 317 1.4e-21
psoriasis 6694 2.4e-14
lung carcinoma 2843 9.7e-13
lung adenocarcinoma 2716 1.3e-09
group 3 medulloblastoma 4104 2.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma -1.400 2.8e-02
lung adenocarcinoma -1.400 1.3e-09
lung carcinoma -2.100 9.7e-13
non-small cell lung carcinoma -1.500 1.4e-21
psoriasis -1.200 2.4e-14

Gene RIF (1)

AA Sequence

MTTIPRKGSSHLPGSLHTCKLKLQEDRRQQEKSVIAQPIFVFEKGEQTFKRPAEDTLYEAAEPECNGFPT      1 - 70
KRVRSSSFTFHITDSQSQGVRKNNVFMTSALVQSSVDIKSAEQGPVKHSKHVIRPAILQLPQARSCAKVR     71 - 140
KTFGHKALESCKTKEKTNNKISEGNSYLLSENLSRARISVQLSTNQDFLGATSVGCQPNEDKCSFKSCSS    141 - 210
NFVFGENMVERVLGTQKLTQPQLENDSYAKEKPFKSIPKFPVNFLSSRTDSIKNTSLIESAAAFSSQPSR    211 - 280
KCLLEKIDVITGEETEHNVLKINCKLFIFNKTTQSWIERGRGTLRLNDTASTDCGTLQSRLIMRNQGSLR    281 - 350
LILNSKLWAQMKIQRANHKNVRITATDLEDYSIKIFLIQASAQDTAYLYAAIHHRLVALQSFNKQRDVNQ    351 - 420
AESLSETAQQLNCESCDENEDDFIQVTKNGSDPSSWTHRQSVACS                             421 - 465
//

Text Mined References (7)

PMID Year Title