Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung carcinoma 413 1.43074343794634E-21
psoriasis 6685 2.41282841601041E-14
lung carcinoma 2844 9.66540652157931E-13
lung adenocarcinoma 2714 1.2689399822071E-9
group 3 medulloblastoma 2254 0.0277717753690617

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma -1.400 0.028
lung adenocarcinoma -1.400 0.000
lung carcinoma -2.100 0.000
non-small cell lung carcinoma -1.500 0.000
psoriasis -1.200 0.000

Synonym

Accession Q86VV4 B7Z866 E9PGP9 Q96LK2
Symbols

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (1)

PMID Text
25755279 Results demonstrate that RanBP3L, as a nuclear exporter for BMP-specific Smads, plays a critical role in terminating BMP signaling and regulating mesenchymal stem cell differentiation.

AA Sequence

MTTIPRKGSSHLPGSLHTCKLKLQEDRRQQEKSVIAQPIFVFEKGEQTFKRPAEDTLYEAAEPECNGFPT      1 - 70
KRVRSSSFTFHITDSQSQGVRKNNVFMTSALVQSSVDIKSAEQGPVKHSKHVIRPAILQLPQARSCAKVR     71 - 140
KTFGHKALESCKTKEKTNNKISEGNSYLLSENLSRARISVQLSTNQDFLGATSVGCQPNEDKCSFKSCSS    141 - 210
NFVFGENMVERVLGTQKLTQPQLENDSYAKEKPFKSIPKFPVNFLSSRTDSIKNTSLIESAAAFSSQPSR    211 - 280
KCLLEKIDVITGEETEHNVLKINCKLFIFNKTTQSWIERGRGTLRLNDTASTDCGTLQSRLIMRNQGSLR    281 - 350
LILNSKLWAQMKIQRANHKNVRITATDLEDYSIKIFLIQASAQDTAYLYAAIHHRLVALQSFNKQRDVNQ    351 - 420
AESLSETAQQLNCESCDENEDDFIQVTKNGSDPSSWTHRQSVACS                             421 - 465
//

Text Mined References (7)

PMID Year Title
25755279 2015 Nuclear Export of Smads by RanBP3L Regulates Bone Morphogenetic Protein Signaling and Mesenchymal Stem Cell Differentiation.
23151678 2013 Impact of four loci on serum tamsulosin hydrochloride concentration.
21626137 2011 Two-marker association tests yield new disease associations for coronary artery disease and hypertension.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.