Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.84
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.1e-04

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.015 1.1e-04

Gene RIF (2)

AA Sequence

MTQPVPRLSVPAALALGSAALGAAFATGLFLGRRCPPWRGRREQCLLPPEDSRLWQYLLSRSMREHPALR      1 - 70
SLRLLTLEQPQGDSMMTCEQAQLLANLARLIQAKKALDLGTFTGYSALALALALPADGRVVTCEVDAQPP     71 - 140
ELGRPLWRQAEAEHKIDLRLKPALETLDELLAAGEAGTFDVAVVDADKENCSAYYERCLQLLRPGGILAV    141 - 210
LRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVYISLLPLGDGLTLAFKI                      211 - 262
//

Text Mined References (14)

PMID Year Title