Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.44
PubTator Score 0.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 7.3e-06
ovarian cancer 8520 2.1e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.826 7.3e-06
ovarian cancer 1.700 2.1e-05

Gene RIF (1)

AA Sequence

MAEAEGVPTTPGPASGSTFRGRRDVSGSWERDQQVEAAQRALVEVLGPYEPLLSRVQAALVWERPARSAL      1 - 70
WCLGLNAAFWFFALTSLRLVFLLAFGLMIIVCIDQWKNKIWPEIKVPRPDALDNESWGFVHPRLLSVPEL     71 - 140
CHHVAEVWVSGTIFIRNVLLFKKQNPGKFCLLSCGILTFLAVLGRYVPGLLLSYLMLVTVMMWPLAVYHR    141 - 210
LWDRAYVRLKPALQRLDFSVRGYMMSKQRERQLRRRALHPERAMDNHSDSEEELAAFCPQLDDSTVAREL    211 - 280
AITDSEHSDAEVSCTDNGTFNLSRGQTPLTEGSEDLDGHSDPEESFARDLPDFPSINMDPAGLDDEDDTS    281 - 350
IGMPSLMYRSPPGAEEPQAPPASRDEAALPELLLGALPVGSNLTSNLASLVSQGMIQLALSGASQPGPSG    351 - 420
APAQRATRGFLRSPSSDLDTDAEGDDFELLDQSELSQLDPASSRSH                            421 - 466
//

Text Mined References (20)

PMID Year Title