Property Summary

NCBI Gene PubMed Count 16
PubMed Score 48.96
PubTator Score 44.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 3.02147154362077E-10
ependymoma 2514 2.61138960360397E-9
ovarian cancer 8492 4.65812942909147E-8
pediatric high grade glioma 2712 1.23539481790658E-7
glioblastoma 5572 9.69435522819749E-6
psoriasis 6685 2.29286544192305E-4
Parkinson's disease 364 0.00985491013911801
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0222175876102283
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (8)

Disease log2 FC p
Parkinson's disease 1.200 0.010
psoriasis 1.700 0.000
osteosarcoma 3.078 0.000
ependymoma -1.200 0.000
glioblastoma -1.300 0.000
intraductal papillary-mucinous neoplasm ... -1.100 0.022
pediatric high grade glioma -1.200 0.000
ovarian cancer 1.800 0.000

Synonym

Accession Q86VP3 A2VDJ9 G8JLK3 O60342 Q6P191 Q96FL7 PACS-2
Symbols PACS-2
PACS1L

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA Inparanoid

Pathway (1)

Gene RIF (13)

PMID Text
24633224 cIAPs constitutively downregulate PACS-2 by polyubiquitination and proteasomal degradation, thereby restraining TRAIL-induced killing of liver cancer cells
22844345 Amino-acid residues 102-116 in the FBR region of PACS-2 bind to HIV-1 Nef and alanine-scanning analysis reveals that amino acid N109 is required for the binding between PACS-2 and Nef
22645134 Tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) protein-induced lysosomal translocation of proapoptotic effectors is mediated by phosphofurin acidic cluster sorting protein-2.
22496420 The sites on Nef and the PACS proteins required for their interaction, are identified.
22496420 Amino-acid residues 102-116 in the FBR region of PACS-2 bind to HIV-1 Nef and alanine-scanning analysis reveals that amino acid N109 is required for the binding between PACS-2 and Nef
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19481529 Results identify PACS-2 as an essential TRAIL effector, and show that Akt cooperates with 14-3-3 to regulate the homeostatic and apoptotic properties of PACS-2 that mediate TRAIL action.
18417615 the phosphorylation state of the calnexin cytosolic domain and its interaction with PACS-2 sort the chaperone between domains of the ER and the plasma membrane
18296443 PACS-2 is required for Nef action and sorting of itinerant membrane cargo in the TGN/endosomal system
More...

AA Sequence

MAERGRLGLPGAPGALNTPVPMNLFATWEVDGSSPSCVPRLCSLTLKKLVVFKELEKELISVVIAVKMQG      1 - 70
SKRILRSHEIVLPPSGQVETDLALTFSLQYPHFLKREGNKLQIMLQRRKRYKNRTILGYKTLAAGSISMA     71 - 140
EVMQHPSEGGQVLSLCSSIKEAPVKAAEIWIASLSSQPIDHEDSTMQAGPKAKSTDNYSEEEYESFSSEQ    141 - 210
EASDDAVQGQDLDEDDFDVGKPKKQRRSIVRTTSMTRQQNFKQKVVALLRRFKVSDEVLDSEQDPAEHIP    211 - 280
EAEEDLDLLYDTLDMEHPSDSGPDMEDDDSVLSTPKPKLRPYFEGLSHSSSQTEIGSIHSARSHKEPPSP    281 - 350
ADVPEKTRSLGGRQPSDSVSDTVALGVPGPREHPGQPEDSPEAEASTLDVFTERLPPSGRITKTESLVIP    351 - 420
STRSEGKQAGRRGRSTSLKERQAARPQNERANSLDNERCPDARSQLQIPRKTVYDQLNHILISDDQLPEN    421 - 490
IILVNTSDWQGQFLSDVLQRHTLPVVCTCSPADVQAAFSTIVSRIQRYCNCNSQPPTPVKIAVAGAQHYL    491 - 560
SAILRLFVEQLSHKTPDWLGYMRFLVIPLGSHPVARYLGSVDYRYNNFFQDLAWRDLFNKLEAQSAVQDT    561 - 630
PDIVSRITQYIAGANCAHQLPIAEAMLTYKQKSPDEESSQKFIPFVGVVKVGIVEPSSATSGDSDDAAPS    631 - 700
GSGTLSSTPPSASPAAKEASPTPPSSPSVSGGLSSPSQGVGAELMGLQVDYWTAAQPADRKRDAEKKDLP    701 - 770
VTKNTLKCTFRSLQVSRLPSSGEAAATPTMSMTVVTKEKNKKVMFLPKKAKDKDVESKSQCIEGISRLIC    771 - 840
TARQQQNMLRVLIDGVECSDVKFFQLAAQWSSHVKHFPICIFGHSKATF                         841 - 889
//

Text Mined References (19)

PMID Year Title
24633224 2014 Cellular inhibitor of apoptosis (cIAP)-mediated ubiquitination of phosphofurin acidic cluster sorting protein 2 (PACS-2) negatively regulates tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) cytotoxicity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23455425 2013 Autophagosomes form at ER-mitochondria contact sites.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22645134 2012 Tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) protein-induced lysosomal translocation of proapoptotic effectors is mediated by phosphofurin acidic cluster sorting protein-2 (PACS-2).
22496420 2012 An interdomain binding site on HIV-1 Nef interacts with PACS-1 and PACS-2 on endosomes to down-regulate MHC-I.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19481529 2009 Akt and 14-3-3 control a PACS-2 homeostatic switch that integrates membrane traffic with TRAIL-induced apoptosis.
18417615 2008 The subcellular distribution of calnexin is mediated by PACS-2.
More...