Property Summary

NCBI Gene PubMed Count 17
PubMed Score 53.85
PubTator Score 44.66

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma -1.200 2.6e-09
glioblastoma -1.300 9.7e-06
intraductal papillary-mucinous neoplasm ... -1.100 2.2e-02
osteosarcoma 3.078 3.0e-10
ovarian cancer 1.800 4.7e-08
Parkinson's disease 1.200 9.9e-03
pediatric high grade glioma -1.200 1.2e-07
psoriasis 1.700 2.3e-04

Gene RIF (14)

AA Sequence

MAERGRLGLPGAPGALNTPVPMNLFATWEVDGSSPSCVPRLCSLTLKKLVVFKELEKELISVVIAVKMQG      1 - 70
SKRILRSHEIVLPPSGQVETDLALTFSLQYPHFLKREGNKLQIMLQRRKRYKNRTILGYKTLAAGSISMA     71 - 140
EVMQHPSEGGQVLSLCSSIKEAPVKAAEIWIASLSSQPIDHEDSTMQAGPKAKSTDNYSEEEYESFSSEQ    141 - 210
EASDDAVQGQDLDEDDFDVGKPKKQRRSIVRTTSMTRQQNFKQKVVALLRRFKVSDEVLDSEQDPAEHIP    211 - 280
EAEEDLDLLYDTLDMEHPSDSGPDMEDDDSVLSTPKPKLRPYFEGLSHSSSQTEIGSIHSARSHKEPPSP    281 - 350
ADVPEKTRSLGGRQPSDSVSDTVALGVPGPREHPGQPEDSPEAEASTLDVFTERLPPSGRITKTESLVIP    351 - 420
STRSEGKQAGRRGRSTSLKERQAARPQNERANSLDNERCPDARSQLQIPRKTVYDQLNHILISDDQLPEN    421 - 490
IILVNTSDWQGQFLSDVLQRHTLPVVCTCSPADVQAAFSTIVSRIQRYCNCNSQPPTPVKIAVAGAQHYL    491 - 560
SAILRLFVEQLSHKTPDWLGYMRFLVIPLGSHPVARYLGSVDYRYNNFFQDLAWRDLFNKLEAQSAVQDT    561 - 630
PDIVSRITQYIAGANCAHQLPIAEAMLTYKQKSPDEESSQKFIPFVGVVKVGIVEPSSATSGDSDDAAPS    631 - 700
GSGTLSSTPPSASPAAKEASPTPPSSPSVSGGLSSPSQGVGAELMGLQVDYWTAAQPADRKRDAEKKDLP    701 - 770
VTKNTLKCTFRSLQVSRLPSSGEAAATPTMSMTVVTKEKNKKVMFLPKKAKDKDVESKSQCIEGISRLIC    771 - 840
TARQQQNMLRVLIDGVECSDVKFFQLAAQWSSHVKHFPICIFGHSKATF                         841 - 889
//

Text Mined References (20)

PMID Year Title