Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.01
PubTator Score 6.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Autism spectrum disorder 101 0.0 0.0
Disease Target Count
Autism Spectrum Disorders 75
Disease Target Count P-value
psoriasis 6694 4.9e-14
lung carcinoma 2843 8.9e-10
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.5
lung cancer 4740 0.0 0.5

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 2.200 8.9e-10
psoriasis -1.500 4.9e-14

Gene RIF (9)

AA Sequence

MGFNVIRLLSGSAVALVIAPTVLLTMLSSAERGCPKGCRCEGKMVYCESQKLQEIPSSISAGCLGLSLRY      1 - 70
NSLQKLKYNQFKGLNQLTWLYLDHNHISNIDENAFNGIRRLKELILSSNRISYFLNNTFRPVTNLRNLDL     71 - 140
SYNQLHSLGSEQFRGLRKLLSLHLRSNSLRTIPVRIFQDCRNLELLDLGYNRIRSLARNVFAGMIRLKEL    141 - 210
HLEHNQFSKLNLALFPRLVSLQNLYLQWNKISVIGQTMSWTWSSLQRLDLSGNEIEAFSGPSVFQCVPNL    211 - 280
QRLNLDSNKLTFIGQEILDSWISLNDISLAGNIWECSRNICSLVNWLKSFKGLRENTIICASPKELQGVN    281 - 350
VIDAVKNYSICGKSTTERFDLARALPKPTFKPKLPRPKHESKPPLPPTVGATEPGPETDADAEHISFHKI    351 - 420
IAGSVALFLSVLVILLVIYVSWKRYPASMKQLQQRSLMRRHRKKKRQSLKQMTPSTQEFYVDYKPTNTET    421 - 490
SEMLLNGTGPCTYNKSGSRECEIPLSMNVSTFLAYDQPTISYCGVHHELLSHKSFETNAQEDTMETHLET    491 - 560
ELDLSTITTAGRISDHKQQLA                                                     561 - 581
//

Text Mined References (15)

PMID Year Title