Property Summary

NCBI Gene PubMed Count 13
Grant Count 1
Funding $33,535.71
PubMed Score 6.61
PubTator Score 6.84

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 2.200 0.000
psoriasis -1.500 0.000

Synonym

Accession Q86VH5 A8K2A3 Q2NKX7 Q6N0A3
Symbols

Gene

 Grant Application (1)

Gene RIF (9)

PMID Text
24463050 LRRTM3 polymorphisms may play a role in the pathogenesis of late-onset Alzheimer's disease (LOAD) in a Northern Han Chinese population.
23750206 protein interactions between LRRTM3, APP and BACE1, as well as complex associations between mRNA levels of LRRTM3, CTNNA3, APP and BACE1 in humans might influence APP metabolism and ultimately risk of AD
22710909 LRRTM3 is not an essential regulator of amyloid-beta production in adult mice; there are no differences in genotype between levels of Abeta or Abeta protein precursor C-terminal fragments in vivo.
22393166 One single-nucleotide polymorphism in the promoter region and a block of 4 single-nucleotide polymorphisms in intron 2 were associated with AD in the National Institute on Aging Late-Onset Alzheimer's Disease data set or the Caribbean Hispanic data set.
21598020 Apart from the complexity of its regulation, alterations in both CTNNA3 and LRTMM3 are implicated in human disease.
20678249 Observational study of gene-disease association. (HuGE Navigator)
19105203 An ancestral risk haplotype clade in ACE and putative multilocus association between ACE, A2M, and LRRTM3 in Alzheimer disease.
19105203 Observational study of gene-disease association. (HuGE Navigator)
17098871 Data suggest that LRRTM3 is a functional and positional candidate gene for Alzheimer disease, and, given its receptor-like structure and restricted expression, a potential therapeutic target.

AA Sequence

MGFNVIRLLSGSAVALVIAPTVLLTMLSSAERGCPKGCRCEGKMVYCESQKLQEIPSSISAGCLGLSLRY      1 - 70
NSLQKLKYNQFKGLNQLTWLYLDHNHISNIDENAFNGIRRLKELILSSNRISYFLNNTFRPVTNLRNLDL     71 - 140
SYNQLHSLGSEQFRGLRKLLSLHLRSNSLRTIPVRIFQDCRNLELLDLGYNRIRSLARNVFAGMIRLKEL    141 - 210
HLEHNQFSKLNLALFPRLVSLQNLYLQWNKISVIGQTMSWTWSSLQRLDLSGNEIEAFSGPSVFQCVPNL    211 - 280
QRLNLDSNKLTFIGQEILDSWISLNDISLAGNIWECSRNICSLVNWLKSFKGLRENTIICASPKELQGVN    281 - 350
VIDAVKNYSICGKSTTERFDLARALPKPTFKPKLPRPKHESKPPLPPTVGATEPGPETDADAEHISFHKI    351 - 420
IAGSVALFLSVLVILLVIYVSWKRYPASMKQLQQRSLMRRHRKKKRQSLKQMTPSTQEFYVDYKPTNTET    421 - 490
SEMLLNGTGPCTYNKSGSRECEIPLSMNVSTFLAYDQPTISYCGVHHELLSHKSFETNAQEDTMETHLET    491 - 560
ELDLSTITTAGRISDHKQQLA                                                     561 - 581
//

Text Mined References (15)

PMID Year Title
24463050 2014 Association of LRRTM3 polymorphisms with late-onset Alzheimer's disease in Han Chinese.
23750206 2013 LRRTM3 interacts with APP and BACE1 and has variants associating with late-onset Alzheimer's disease (LOAD).
22710909 2012 LRRTM3 is dispensable for amyloid-? production in mice.
22393166 2012 Effect of genetic variation in LRRTM3 on risk of Alzheimer disease.
21598020 2011 Alpha T-catenin (CTNNA3): a gene in the hand is worth two in the nest.
20678249 2010 Polymorphisms in leucine-rich repeat genes are associated with autism spectrum disorder susceptibility in populations of European ancestry.
19105203 2009 An association analysis of Alzheimer disease candidate genes detects an ancestral risk haplotype clade in ACE and putative multilocus association between ACE, A2M, and LRRTM3.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17098871 2006 LRRTM3 promotes processing of amyloid-precursor protein by BACE1 and is a positional candidate gene for late-onset Alzheimer's disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...