Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 2.76831962537556E-19
malignant mesothelioma 3163 4.75501464499898E-8
Amyotrophic Lateral Sclerosis 432 1.45731569524641E-7
Duchenne muscular dystrophy 602 6.21307781818044E-7
Breast cancer 3099 1.81743621405332E-5
cystic fibrosis 1670 3.63404020256517E-5
medulloblastoma, large-cell 6234 4.92217092192157E-5
ovarian cancer 8492 5.08477961025805E-5
sonic hedgehog group medulloblastoma 1482 1.09204008792665E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.92813442370818E-4
adult high grade glioma 2148 2.59606366927104E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 3.07721819941639E-4
limb girdle muscular dystrophy 2A 156 8.08727580171144E-4
psoriasis 6685 0.00113172939091382
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00199255517588261
acute quadriplegic myopathy 1157 0.00202164210568197
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00318123763728669
Pick disease 1893 0.00723263382292932
glioblastoma 5572 0.0088443214383538
osteosarcoma 7933 0.0116282036284751
colon cancer 1475 0.020356024321853
oligodendroglioma 2849 0.0311005642838749
ependymoma 2514 0.0316022331287695
subependymal giant cell astrocytoma 2287 0.0368512891253366
astrocytic glioma 2241 0.046241376628511

Expression

AA Sequence

MSKTMAMNLLEDWCRGMEVDIHRSLLVTGIPEDCGQAEIEETLNGVLSPLGPYRVLNKIFVREENVKAAL      1 - 70
IEVGEGVNLSTIPREFPGRGGVWRVVCRDPTQDAEFLKNLNEFLDAEGRTWEDVVRLLQLNHPTLSQNQH     71 - 140
QPPENWAEALGVLLGAVVQIIFCMDAEIRSREEARAQEAAEFEEMAAWALAAGRKVKKEPGLAAEVGSAL    141 - 210
KAETPNNWNATEDQHEPTKPLVRRAGAKSRSRRKKQKKNSRQEAVPWKKPKGINSNSTANLEDPEVGDAE    211 - 280
SMAISEPIKGSRKPCVNKEELALKKPMAKCAWKGPREPPQDARAEAESPGGASESDQDGGHESPPKKKAV    281 - 350
AWVSAKNPAPMRKKKKVSLGPVSYVLVDSEDGRKKPVMPKKGPGSRREASDQKAPRGQQPAEATASTSRG    351 - 420
PKAKPEGSPRRATNESRKV                                                       421 - 439
//

Text Mined References (14)

PMID Year Title
24743840 2014 Genome-wide diet-gene interaction analyses for risk of colorectal cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16550607 2006 Identification of novel oligodendroglioma-associated candidate tumor suppressor genes in 1p36 and 19q13 using microarray-based expression profiling.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...