Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.100 1.8e-02
astrocytic glioma -1.500 3.2e-02
Astrocytoma, Pilocytic -1.200 4.8e-05
interstitial cystitis 1.100 3.8e-03
osteosarcoma 1.052 2.1e-05
ovarian cancer -1.300 4.5e-06
Pick disease -1.100 2.7e-02
subependymal giant cell astrocytoma -1.771 2.4e-02

Synonym

Accession Q86V42 A2A324 Q8N8P9 Q8NE66 Q96NJ9
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

MDPKAGGGGEEDDCVDSGAETGGSDYSHLSSTSSELSVEEAQDPFLVSIHIIADPGESQPLQEAIDNVLA      1 - 70
WIHPDLPLFRVSERRASRRRRKPPKGAQPALAVVLFLQEEYGEEQILQLHRTLQQPPWRHHHTEQVHGRF     71 - 140
LPYLPCSQDFFTLAPGTPLWAIRPVHYGKEIVRFTVYCRYDNYADSLRFYQLILRRSPSQKKADFCIFPI    141 - 210
FSNLDVDIQFSLKRLPCDQCPVPTDSSVLEFRVRDIGELVPLLPNPCSPISEGRWQTEDHDGNKILLQAQ    211 - 280
RVHKKFPKPGRVHHASEKKRHSTPLPSTAVPSHTPGSSQQSPLNSPHPGPIRTGLPPGHQQEFAGRANST    281 - 350
PNPPWSFQRSKSLFCLPTGGPSLASSAEPQWFSNTGAPGHRASEWRHGHLLSIDDLEGAQETDVDTGLRL    351 - 420
SSSDLSVVSAYSAPSRFCSTVETPLPSERCSSHWAAHKDSREGPLPTVSRVTTEASWASLPFFTKRSSSS    421 - 490
SATARAAPPAPSTSTLTDSSPQLPCDTPKVKQTDGDMPPPPGSAGPGDNDMEEFYI                  491 - 546
//

Text Mined References (10)

PMID Year Title