Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 4.51030790980159E-6
osteosarcoma 7933 2.12998068182755E-5
pilocytic astrocytoma 3086 4.88026634229238E-5
pediatric high grade glioma 2712 5.90572224422562E-4
interstitial cystitis 2299 0.00378508539876638
subependymal giant cell astrocytoma 2287 0.0235717627617159
Pick disease 1893 0.026955724872124
astrocytic glioma 2241 0.032352689646119

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.500 0.032
osteosarcoma 1.052 0.000
interstitial cystitis 1.100 0.004
pediatric high grade glioma -1.200 0.001
pilocytic astrocytoma -1.200 0.000
subependymal giant cell astrocytoma -1.771 0.024
Pick disease -1.100 0.027
ovarian cancer -1.300 0.000

Synonym

Accession Q86V42 A2A324 Q8N8P9 Q8NE66 Q96NJ9
Symbols

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

 Compartment GO Term (2)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDPKAGGGGEEDDCVDSGAETGGSDYSHLSSTSSELSVEEAQDPFLVSIHIIADPGESQPLQEAIDNVLA      1 - 70
WIHPDLPLFRVSERRASRRRRKPPKGAQPALAVVLFLQEEYGEEQILQLHRTLQQPPWRHHHTEQVHGRF     71 - 140
LPYLPCSQDFFTLAPGTPLWAIRPVHYGKEIVRFTVYCRYDNYADSLRFYQLILRRSPSQKKADFCIFPI    141 - 210
FSNLDVDIQFSLKRLPCDQCPVPTDSSVLEFRVRDIGELVPLLPNPCSPISEGRWQTEDHDGNKILLQAQ    211 - 280
RVHKKFPKPGRVHHASEKKRHSTPLPSTAVPSHTPGSSQQSPLNSPHPGPIRTGLPPGHQQEFAGRANST    281 - 350
PNPPWSFQRSKSLFCLPTGGPSLASSAEPQWFSNTGAPGHRASEWRHGHLLSIDDLEGAQETDVDTGLRL    351 - 420
SSSDLSVVSAYSAPSRFCSTVETPLPSERCSSHWAAHKDSREGPLPTVSRVTTEASWASLPFFTKRSSSS    421 - 490
SATARAAPPAPSTSTLTDSSPQLPCDTPKVKQTDGDMPPPPGSAGPGDNDMEEFYI                  491 - 546
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24532677 2015 A genome-wide association study of rheumatoid arthritis without antibodies against citrullinated peptides.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.