Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.43
PubTator Score 5.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.228 0.000
group 3 medulloblastoma 3.100 0.005
atypical teratoid / rhabdoid tumor -1.400 0.003
pilocytic astrocytoma 1.600 0.032
lung adenocarcinoma 2.500 0.002
lung carcinoma 1.900 0.000

Synonym

Accession Q86V35 CaBP7
Symbols CALN2

Gene

PDB

2LV7  

Gene RIF (3)

PMID Text
25717182 CaBP7 regulates lysosome clustering at the intercellular bridge during cytokinesis in HeLa cells. CaBP7 depletion induces lysosome mislocalization, extension of intercellular bridge lifetime, and cytokinesis failure.
22989873 Data indicate that the Ca(2+)-bound form of calcium-binding protein 7 (CaBP7) N-terminal domain (NTD) is monomeric and exhibits an open conformation.
19338761 CaBP7 and 8 possess a targeting mechanism that is unique amongst the CaBPs that may contribute to differential functional Ca(2+)-sensing by these family members.

AA Sequence

MPFHPVTAALMYRGIYTVPNLLSEQRPVDIPEDELEEIREAFKVFDRDGNGFISKQELGTAMRSLGYMPN      1 - 70
EVELEVIIQRLDMDGDGQVDFEEFVTLLGPKLSTSGIPEKFHGTDFDTVFWKCDMQKLTVDELKRLLYDT     71 - 140
FCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQIRQTCVRKSLICAFAIAFIISVMLIAANQVL    141 - 210
RSGMK                                                                     211 - 215
//

Text Mined References (7)

PMID Year Title
25717182 2015 Modulation of phosphatidylinositol 4-phosphate levels by CaBP7 controls cytokinesis in mammalian cells.
22989873 2012 Solution NMR structure of the Ca2+-bound N-terminal domain of CaBP7: a regulator of golgi trafficking.
19338761 2009 Membrane targeting of the EF-hand containing calcium-sensing proteins CaBP7 and CaBP8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11785943 2002 Calcium-binding proteins: intracellular sensors from the calmodulin superfamily.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.