Property Summary

NCBI Gene PubMed Count 10
PubMed Score 41.87
PubTator Score 4.83

Knowledge Summary

Patent (2,155)

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.700 3.7e-04
astrocytic glioma -1.100 3.1e-03
Astrocytoma, Pilocytic -1.200 1.3e-04
atypical teratoid / rhabdoid tumor -1.900 1.5e-07
ependymoma -1.200 7.1e-03
glioblastoma -1.200 2.8e-05
medulloblastoma -1.200 1.6e-02
medulloblastoma, large-cell -1.400 7.7e-03
osteosarcoma -1.190 5.2e-04
primitive neuroectodermal tumor -1.500 1.7e-03

Gene RIF (1)

AA Sequence

MRSGAERRGSSAAASPGSPPPGRARPAGSDAPSALPPPAAGQPRARDSGDVRSQPRPLFQWSKWKKRMGS      1 - 70
SMSAATARRPVFDDKEDVNFDHFQILRAIGKGSFGKVCIVQKRDTEKMYAMKYMNKQQCIERDEVRNVFR     71 - 140
ELEILQEIEHVFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVQFSEDTVRLYICEMALALDYLRGQ    141 - 210
HIIHRDVKPDNILLDERGHAHLTDFNIATIIKDGERATALAGTKPYMAPEIFHSFVNGGTGYSFEVDWWS    211 - 280
VGVMAYELLRGWRPYDIHSSNAVESLVQLFSTVSVQYVPTWSKEMVALLRKLLTVNPEHRLSSLQDVQAA    281 - 350
PALAGVLWDHLSEKRVEPGFVPNKGRLHCDPTFELEEMILESRPLHKKKKRLAKNKSRDNSRDSSQSEND    351 - 420
YLQDCLDAIQQDFVIFNREKLKRSQDLPREPLPAPESRDAAEPVEDEAERSALPMCGPICPSAGSG        421 - 486
//

Text Mined References (14)

PMID Year Title