Property Summary

NCBI Gene PubMed Count 10
PubMed Score 40.07
PubTator Score 4.83

Knowledge Summary

Patent (2,155)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.46345116390296E-7
glioblastoma 5572 6.80633052882156E-5
pilocytic astrocytoma 3086 1.02634320017872E-4
adult high grade glioma 2148 3.69049628605865E-4
osteosarcoma 7933 5.23109864207346E-4
primitive neuroectodermal tumor 3031 0.00165232766680908
astrocytic glioma 2241 0.00307941831080021
ependymoma 2514 0.00709381680993117
medulloblastoma, large-cell 6234 0.00774040823191009
medulloblastoma 1524 0.0162680631912617
Disease Target Count Z-score Confidence
Trigeminal neuralgia 13 3.752 1.9
Senile cataract 4 3.19 1.6
Endophthalmitis 10 3.155 1.6

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.100 0.003
ependymoma -1.200 0.007
osteosarcoma -1.190 0.001
glioblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma -1.200 0.016
medulloblastoma, large-cell -1.400 0.008
primitive neuroectodermal tumor -1.500 0.002
adult high grade glioma -1.700 0.000
pilocytic astrocytoma -1.300 0.000

Synonym

Accession Q86UX6 Q5T0Q5 Q86UE1
Symbols PKE
YANK3

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (1)

PMID Text
20580033 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRSGAERRGSSAAASPGSPPPGRARPAGSDAPSALPPPAAGQPRARDSGDVRSQPRPLFQWSKWKKRMGS      1 - 70
SMSAATARRPVFDDKEDVNFDHFQILRAIGKGSFGKVCIVQKRDTEKMYAMKYMNKQQCIERDEVRNVFR     71 - 140
ELEILQEIEHVFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVQFSEDTVRLYICEMALALDYLRGQ    141 - 210
HIIHRDVKPDNILLDERGHAHLTDFNIATIIKDGERATALAGTKPYMAPEIFHSFVNGGTGYSFEVDWWS    211 - 280
VGVMAYELLRGWRPYDIHSSNAVESLVQLFSTVSVQYVPTWSKEMVALLRKLLTVNPEHRLSSLQDVQAA    281 - 350
PALAGVLWDHLSEKRVEPGFVPNKGRLHCDPTFELEEMILESRPLHKKKKRLAKNKSRDNSRDSSQSEND    351 - 420
YLQDCLDAIQQDFVIFNREKLKRSQDLPREPLPAPESRDAAEPVEDEAERSALPMCGPICPSAGSG        421 - 486
//

Text Mined References (14)

PMID Year Title
24929637 2014 Genome-wide methylomic analysis of monozygotic twins discordant for adolescent depression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20580033 2010 Replication of recently described type 2 diabetes gene variants in a South Indian population.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
More...