Property Summary

NCBI Gene PubMed Count 17
PubMed Score 84.45
PubTator Score 23.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Cholestasis 155 3.217 1.6
Liver Cirrhosis, Biliary 33 0.0 0.0
Disease Target Count
Biliary cirrhosis 45
Disease Target Count P-value
osteosarcoma 7950 4.1e-06
active Crohn's disease 922 1.0e-03
active ulcerative colitis 764 2.2e-02
Disease Target Count Z-score Confidence
Osteoporosis 363 5.412 2.7

Expression

  Differential Expression (3)

Disease log2 FC p
active Crohn's disease -4.085 1.0e-03
active ulcerative colitis -2.591 2.2e-02
osteosarcoma -2.330 4.1e-06

Gene RIF (13)

AA Sequence

MEPGRTQIKLDPRYTADLLEVLKTNYGIPSACFSQPPTAAQLLRALGPVELALTSILTLLALGSIAIFLE      1 - 70
DAVYLYKNTLCPIKRRTLLWKSSAPTVVSVLCCFGLWIPRSLVLVEMTITSFYAVCFYLLMLVMVEGFGG     71 - 140
KEAVLRTLRDTPMMVHTGPCCCCCPCCPRLLLTRKKLQLLMLGPFQYAFLKITLTLVGLFLVPDGIYDPA    141 - 210
DISEGSTALWINTFLGVSTLLALWTLGIISRQARLHLGEQNMGAKFALFQVLLILTALQPSIFSVLANGG    211 - 280
QIACSPPYSSKTRSQVMNCHLLILETFLMTVLTRMYYRRKDHKVGYETFSSPDLDLNLKA              281 - 340
//

Text Mined References (18)

PMID Year Title