Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.39
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 4.4e-03
Disease Target Count Z-score Confidence
Williams-Beuren syndrome 50 5.013 2.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 4.4e-03

Gene RIF (1)

AA Sequence

MAWQVSLLELEDWLQCPICLEVFKESLMLQCGHSYCKGCLVSLSYHLDTKVRCPMCWQVVDGSSSLPNVS      1 - 70
LAWVIEALRLPGDPEPKVCVHHRNPLSLFCEKDQELICGLCGLLGSHQHHPVTPVSTVCSRMKEELAALF     71 - 140
SELKQEQKKVDELIAKLVKNRTRIVNESDVFSWVIRREFQELRHPVDEEKARCLEGIGGHTRGLVASLDM    141 - 210
QLEQAQGTRERLAQAECVLEQFGNEDHHEFIWKFHSMASR                                  211 - 250
//

Text Mined References (6)

PMID Year Title