Property Summary

NCBI Gene PubMed Count 5
Grant Count 2
R01 Count 2
Funding $196,234.25
PubMed Score 3.33
PubTator Score 1.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.852 0.000
atypical teratoid / rhabdoid tumor 1.500 0.000
glioblastoma 1.100 0.001
medulloblastoma 1.500 0.000
medulloblastoma, large-cell 1.700 0.000
primitive neuroectodermal tumor 1.900 0.000
colon cancer 1.200 0.012
lung cancer 1.600 0.003
Breast cancer -2.900 0.032
Pick disease 1.100 0.002

Gene RIF (1)

PMID Text
26738774 The stem cell zinc finger 1 (SZF1)/ZNF589 protein has a human-specific evolutionary nucleotide DNA change and acts as a regulator of cell viability in the hematopoietic system

AA Sequence

MWAPREQLLGWTAEALPAKDSAWPWEEKPRYLGPVTFEDVAVLFTEAEWKRLSLEQRNLYKEVMLENLRN      1 - 70
LVSLAESKPEVHTCPSCPLAFGSQQFLSQDELHNHPIPGFHAGNQLHPGNPCPEDQPQSQHPSDKNHRGA     71 - 140
EAEDQRVEGGVRPLFWSTNERGALVGFSSLFQRPPISSWGGNRILEIQLSPAQNASSEEVDRISKRAETP    141 - 210
GFGAVTFGECALAFNQKSNLFRQKAVTAEKSSDKRQSQVCRECGRGFSRKSQLIIHQRTHTGEKPYVCGE    211 - 280
CGRGFIVESVLRNHLSTHSGEKPYVCSHCGRGFSCKPYLIRHQRTHTREKSFMCTVCGRGFREKSELIKH    281 - 350
QRIHTGDKPYVCRD                                                            351 - 364
//

Text Mined References (9)

PMID Year Title
26738774 2016 The stem cell zinc finger 1 (SZF1)/ZNF589 protein has a human-specific evolutionary nucleotide DNA change and acts as a regulator of cell viability in the hematopoietic system.
23665872 2013 Novel activity of KRAB domain that functions to reinforce nuclear localization of KRAB-containing zinc finger proteins by interacting with KAP1.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12097288 2002 A common DNA-binding site for SZF1 and the BRCA1-associated zinc finger protein, ZBRK1.
10029171 1999 SZF1: a novel KRAB-zinc finger gene expressed in CD34+ stem/progenitor cells.