Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.33
PubTator Score 1.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 1.59571969225622E-7
atypical teratoid / rhabdoid tumor 4369 8.24712296727877E-7
medulloblastoma 1524 4.5568160469233E-6
primitive neuroectodermal tumor 3031 2.28611578190785E-5
medulloblastoma, large-cell 6234 3.15745214028902E-5
glioblastoma 5572 8.56471450725702E-4
Pick disease 1893 0.0018556423381815
lung cancer 4473 0.00324616941044151
colon cancer 1475 0.0122345333817578
Breast cancer 3099 0.0320091733426168
Disease Target Count Z-score Confidence
Kleefstra syndrome 9 5.036 2.5

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.852 0.000
atypical teratoid / rhabdoid tumor 1.500 0.000
glioblastoma 1.100 0.001
medulloblastoma 1.500 0.000
medulloblastoma, large-cell 1.700 0.000
primitive neuroectodermal tumor 1.900 0.000
colon cancer 1.200 0.012
lung cancer 1.600 0.003
Breast cancer -2.900 0.032
Pick disease 1.100 0.002

Synonym

Accession Q86UQ0 Q86UC9 Q9BRI6 Q9BRY3 Q9Y611 Q9Y612
Symbols SZF1

Gene

  Ortholog (2)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid

Gene RIF (1)

PMID Text
26738774 The stem cell zinc finger 1 (SZF1)/ZNF589 protein has a human-specific evolutionary nucleotide DNA change and acts as a regulator of cell viability in the hematopoietic system

AA Sequence

MWAPREQLLGWTAEALPAKDSAWPWEEKPRYLGPVTFEDVAVLFTEAEWKRLSLEQRNLYKEVMLENLRN      1 - 70
LVSLAESKPEVHTCPSCPLAFGSQQFLSQDELHNHPIPGFHAGNQLHPGNPCPEDQPQSQHPSDKNHRGA     71 - 140
EAEDQRVEGGVRPLFWSTNERGALVGFSSLFQRPPISSWGGNRILEIQLSPAQNASSEEVDRISKRAETP    141 - 210
GFGAVTFGECALAFNQKSNLFRQKAVTAEKSSDKRQSQVCRECGRGFSRKSQLIIHQRTHTGEKPYVCGE    211 - 280
CGRGFIVESVLRNHLSTHSGEKPYVCSHCGRGFSCKPYLIRHQRTHTREKSFMCTVCGRGFREKSELIKH    281 - 350
QRIHTGDKPYVCRD                                                            351 - 364
//

Text Mined References (9)

PMID Year Title
26738774 2016 The stem cell zinc finger 1 (SZF1)/ZNF589 protein has a human-specific evolutionary nucleotide DNA change and acts as a regulator of cell viability in the hematopoietic system.
23665872 2013 Novel activity of KRAB domain that functions to reinforce nuclear localization of KRAB-containing zinc finger proteins by interacting with KAP1.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12097288 2002 A common DNA-binding site for SZF1 and the BRCA1-associated zinc finger protein, ZBRK1.
10029171 1999 SZF1: a novel KRAB-zinc finger gene expressed in CD34+ stem/progenitor cells.