Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.41
PubTator Score 1.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 8.2e-07
Breast cancer -2.900 3.2e-02
colon cancer 1.200 1.2e-02
glioblastoma 1.100 8.6e-04
lung cancer 1.600 3.2e-03
medulloblastoma 1.500 4.6e-06
medulloblastoma, large-cell 1.700 3.2e-05
osteosarcoma -1.398 5.3e-05
Pick disease 1.100 1.9e-03
primitive neuroectodermal tumor 1.900 2.3e-05

Gene RIF (1)

AA Sequence

MWAPREQLLGWTAEALPAKDSAWPWEEKPRYLGPVTFEDVAVLFTEAEWKRLSLEQRNLYKEVMLENLRN      1 - 70
LVSLAESKPEVHTCPSCPLAFGSQQFLSQDELHNHPIPGFHAGNQLHPGNPCPEDQPQSQHPSDKNHRGA     71 - 140
EAEDQRVEGGVRPLFWSTNERGALVGFSSLFQRPPISSWGGNRILEIQLSPAQNASSEEVDRISKRAETP    141 - 210
GFGAVTFGECALAFNQKSNLFRQKAVTAEKSSDKRQSQVCRECGRGFSRKSQLIIHQRTHTGEKPYVCGE    211 - 280
CGRGFIVESVLRNHLSTHSGEKPYVCSHCGRGFSCKPYLIRHQRTHTREKSFMCTVCGRGFREKSELIKH    281 - 350
QRIHTGDKPYVCRD                                                            351 - 364
//

Text Mined References (9)

PMID Year Title