Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.02
PubTator Score 10.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (4)

AA Sequence

MAQVAVSTLPVEEESSSETRMVVTFLVSALESMCKELAKSKAEVACIAVYETDVFVVGTERGCAFVNART      1 - 70
DFQKDFAKYCVAEGLCEVKPPCPVNGMQVHSGETEILRKAVEDYFCFCYGKALGTTVMVPVPYEKMLRDQ     71 - 140
SAVVVQGLPEGVAFQHPENYDLATLKWILENKAGISFIINRPFLGPESQLGGPGMVTDAERSIVSPSESC    141 - 210
GPINVKTEPMEDSGISLKAEAVSVKKESEDPNYYQYNMQGSHPSSTSNEVIEMELPMEDSTPLVPSEEPN    211 - 280
EDPEAEVKIEGNTNSSSVTNSAAGVEDLNIVQVTVPDNEKERLSSIEKIKQLREQVNDLFSRKFGEAIGV    281 - 350
DFPVKVPYRKITFNPGCVVIDGMPPGVVFKAPGYLEISSMRRILEAAEFIKFTVIRPLPGLELSNVGKRK    351 - 420
IDQEGRVFQEKWERAYFFVEVQNIPTCLICKQSMSVSKEYNLRRHYQTNHSKHYDQYMERMRDEKLHELK    421 - 490
KGLRKYLLGLSDTECPEQKQVFAHPSPTQKSPVQPVEDLAGNLWEKLREKIRSFVAYSIAIDEITDINNT    491 - 560
TQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIFSRVEKSLKKFCIDWSKLVSVASTGTPAMVDANNG    561 - 630
LVTKLKSRVATFCKGAELKSICCIIHPESLCAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDS    631 - 700
QYGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISL    701 - 770
QGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTLKLASRNESDGLNYIPKIAELKTEFQKRLSDF    771 - 840
KLYESELTLFSSPFSTKIDSVHEELQMEVIDLQCNTVLKTKYDKVGIPEFYKYLWGSYPKYKHHCAKILS    841 - 910
MFGSTYICEQLFSIMKLSKTKYCSQLKDSQWDSVLHIAT                                   911 - 949
//

Text Mined References (15)

PMID Year Title