Property Summary

NCBI Gene PubMed Count 12
PubMed Score 10.27
PubTator Score 12.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
malignant mesothelioma 3163 2.30143959847938E-9
intraductal papillary-mucinous adenoma (IPMA) 2956 1.43029594821648E-6
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.10533241114182E-6
intraductal papillary-mucinous neoplasm (IPMN) 3289 2.59030096077197E-4
osteosarcoma 7933 0.00100293345908855
lung cancer 4473 0.00216530201079955
pancreatic cancer 2300 0.0131911018556186
Disease Target Count Z-score Confidence
Crohn's disease 304 3.764 1.9

Expression

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA Inparanoid

Pathway (1)

Gene RIF (4)

PMID Text
25968583 Totals of 12.4% and 20.8% of Crohn's disease patients were positive for IgA/IgG type of anti-GP2 and anti-CUZD1, respectively. Positivity for anti-pancreatic autoantibodies predicted a faster progression towards complicated disease course.
23710207 CUZD1 appears to be one of the relatively few biomarkers that serve as both cancer biomarker and autoantigen of autoantibodies in an autoimmune disease unrelated to cancerous organs. (Review)
22985796 CUZD1 appears to be a highly promising novel serum biomarker for ovarian cancer diagnosis.
16862170 human UO-44 gene expression may prove to be valuable pretreatment targets for antitumor therapy

AA Sequence

MELVRRLMPLTLLILSCLAELTMAEAEGNASCTVSLGGANMAETHKAMILQLNPSENCTWTIERPENKSI      1 - 70
RIIFSYVQLDPDGSCESENIKVFDGTSSNGPLLGQVCSKNDYVPVFESSSSTLTFQIVTDSARIQRTVFV     71 - 140
FYYFFSPNISIPNCGGYLDTLEGSFTSPNYPKPHPELAYCVWHIQVEKDYKIKLNFKEIFLEIDKQCKFD    141 - 210
FLAIYDGPSTNSGLIGQVCGRVTPTFESSSNSLTVVLSTDYANSYRGFSASYTSIYAENINTTSLTCSSD    211 - 280
RMRVIISKSYLEAFNSNGNNLQLKDPTCRPKLSNVVEFSVPLNGCGTIRKVEDQSITYTNIITFSASSTS    281 - 350
EVITRQKQLQIIVKCEMGHNSTVEIIYITEDDVIQSQNALGKYNTSMALFESNSFEKTILESPYYVDLNQ    351 - 420
TLFVQVSLHTSDPNLVVFLDTCRASPTSDFASPTYDLIKSGCSRDETCKVYPLFGHYGRFQFNAFKFLRS    421 - 490
MSSVYLQCKVLICDSSDHQSRCNQGCVSRSKRDISSYKWKTDSIIGPIRLKRDRSASGNSGFQHETHAEE    491 - 560
TPNQPFNSVHLFSFMVLALNVVTVATITVRHFVNQRADYKYQKLQNY                           561 - 607
//

Text Mined References (15)

PMID Year Title
25968583 2015 Rediscovery of the Anti-Pancreatic Antibodies and Evaluation of their Prognostic Value in a Prospective Clinical Cohort of Crohn's Patients: The Importance of Specific Target Antigens [GP2 and CUZD1].
23710207 2013 CUZD1 and anti-CUZD1 antibodies as markers of cancer and inflammatory bowel diseases.
22985796 2012 CUB and zona pellucida-like domain-containing protein 1 (CUZD1): a novel serological biomarker for ovarian cancer.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16862170 2007 Silencing expression of UO-44 (CUZD1) using small interfering RNA sensitizes human ovarian cancer cells to cisplatin in vitro.
15588985 2005 Substrate-trapping techniques in the identification of cellular PTP targets.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15184879 2004 Molecular cloning, characterization and isolation of novel spliced variants of the human ortholog of a rat estrogen-regulated membrane-associated protein, UO-44.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...